KEGG   Homo sapiens (human): 7351Help
Entry
7351              CDS       T01001                                 

Gene name
UCP2, BMIQ4, SLC25A8, UCPH
Definition
(RefSeq) uncoupling protein 2
  KO
K15103  solute carrier family 25 (mitochondrial uncoupling protein), member 8/9
Organism
hsa  Homo sapiens (human)
Disease
H02106  Genetic obesity
Brite
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   7351 (UCP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 7351
NCBI-ProteinID: NP_003346
OMIM: 601693
HGNC: 12518
Ensembl: ENSG00000175567
Vega: OTTHUMG00000168095
Pharos: P55851(Tbio)
UniProt: P55851 A0A024R5N5
Position
11q13.4
AA seq 309 aa AA seqDB search
MVGFKATDVPPTATVKFLGAGTAACIADLITFPLDTAKVRLQIQGESQGPVRATASAQYR
GVMGTILTMVRTEGPRSLYNGLVAGLQRQMSFASVRIGLYDSVKQFYTKGSEHASIGSRL
LAGSTTGALAVAVAQPTDVVKVRFQAQARAGGGRRYQSTVNAYKTIAREEGFRGLWKGTS
PNVARNAIVNCAELVTYDLIKDALLKANLMTDDLPCHFTSAFGAGFCTTVIASPVDVVKT
RYMNSALGQYSSAGHCALTMLQKEGPRAFYKGFMPSFLRLGSWNVVMFVTYEQLKRALMA
ACTSREAPF
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggttgggttcaaggccacagatgtgccccctactgccactgtgaagtttcttggggct
ggcacagctgcctgcatcgcagatctcatcacctttcctctggatactgctaaagtccgg
ttacagatccaaggagaaagtcaggggccagtgcgcgctacagccagcgcccagtaccgc
ggtgtgatgggcaccattctgaccatggtgcgtactgagggcccccgaagcctctacaat
gggctggttgccggcctgcagcgccaaatgagctttgcctctgtccgcatcggcctgtat
gattctgtcaaacagttctacaccaagggctctgagcatgccagcattgggagccgcctc
ctagcaggcagcaccacaggtgccctggctgtggctgtggcccagcccacggatgtggta
aaggtccgattccaagctcaggcccgggctggaggtggtcggagataccaaagcaccgtc
aatgcctacaagaccattgcccgagaggaagggttccggggcctctggaaagggacctct
cccaatgttgctcgtaatgccattgtcaactgtgctgagctggtgacctatgacctcatc
aaggatgccctcctgaaagccaacctcatgacagatgacctcccttgccacttcacttct
gcctttggggcaggcttctgcaccactgtcatcgcctcccctgtagacgtggtcaagacg
agatacatgaactctgccctgggccagtacagtagcgctggccactgtgcccttaccatg
ctccagaaggaggggccccgagccttctacaaagggttcatgccctcctttctccgcttg
ggttcctggaacgtggtgatgttcgtcacctatgagcagctgaaacgagccctcatggct
gcctgcacttcccgagaggctcccttctga

DBGET integrated database retrieval system