KEGG   Homo sapiens (human): 7352
Entry
7352              CDS       T01001                                 

Gene name
UCP3, SLC25A9
Definition
(RefSeq) uncoupling protein 3
  KO
K15103  solute carrier family 25 (mitochondrial uncoupling protein), member 8/9
Organism
hsa  Homo sapiens (human)
Disease
H02106  Genetic obesity
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7352 (UCP3)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   7352 (UCP3)
SSDB
Motif
Pfam: Mito_carr
Other DBs
NCBI-GeneID: 7352
NCBI-ProteinID: NP_003347
OMIM: 602044
HGNC: 12519
Ensembl: ENSG00000175564
Vega: OTTHUMG00000168109
Pharos: P55916(Tbio)
UniProt: P55916 A0A0S2Z4G5
Position
11q13.4
AA seq 312 aa
MVGLKPSDVPPTMAVKFLGAGTAACFADLVTFPLDTAKVRLQIQGENQAVQTARLVQYRG
VLGTILTMVRTEGPCSPYNGLVAGLQRQMSFASIRIGLYDSVKQVYTPKGADNSSLTTRI
LAGCTTGAMAVTCAQPTDVVKVRFQASIHLGPSRSDRKYSGTMDAYRTIAREEGVRGLWK
GTLPNIMRNAIVNCAEVVTYDILKEKLLDYHLLTDNFPCHFVSAFGAGFCATVVASPVDV
VKTRYMNSPPGQYFSPLDCMIKMVAQEGPTAFYKGFTPSFLRLGSWNVVMFVTYEQLKRA
LMKVQMLRESPF
NT seq 939 nt   +upstreamnt  +downstreamnt
atggttggactgaagccttcagacgtgcctcccaccatggctgtgaagttcctgggggca
ggcacagcagcctgttttgctgacctcgttacctttccactggacacagccaaggtccgc
ctgcagatccagggggagaaccaggcggtccagacggcccggctcgtgcagtaccgtggc
gtgctgggcaccatcctgaccatggtgcggactgagggtccctgcagcccctacaatggg
ctggtggccggcctgcagcgccagatgagcttcgcctccatccgcatcggcctctatgac
tccgtcaagcaggtgtacacccccaaaggcgcggacaactccagcctcactacccggatt
ttggccggctgcaccacaggagccatggcggtgacctgtgcccagcccacagatgtggtg
aaggtccgatttcaggccagcatacacctcgggccatccaggagcgacagaaaatacagc
gggactatggacgcctacagaaccatcgccagggaggaaggagtcaggggcctgtggaaa
ggaactttgcccaacatcatgaggaatgctatcgtcaactgtgctgaggtggtgacctac
gacatcctcaaggagaagctgctggactaccacctgctcactgacaacttcccctgccac
tttgtctctgcctttggagccggcttctgtgccacagtggtggcctccccggtggacgtg
gtgaagacccggtatatgaactcacctccaggccagtacttcagccccctcgactgtatg
ataaagatggtggcccaggagggccccacagccttctacaagggatttacaccctccttt
ttgcgtttgggatcctggaacgtggtgatgttcgtaacctatgagcagctgaaacgggcc
ctgatgaaagtccagatgttacgggaatcaccgttttga

DBGET integrated database retrieval system