KEGG   Homo sapiens (human): 7353
Entry
7353              CDS       T01001                                 

Symbol
UFD1, UFD1L
Name
(RefSeq) ubiquitin recognition factor in ER associated degradation 1
  KO
K14016  ubiquitin fusion degradation protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7353 (UFD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:hsa03009]
    7353 (UFD1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control complex
    7353 (UFD1)
SSDB
Motif
Pfam: UFD1 CDC48_2
Other DBs
NCBI-GeneID: 7353
NCBI-ProteinID: NP_005650
OMIM: 601754
HGNC: 12520
Ensembl: ENSG00000070010
Vega: OTTHUMG00000150130
Pharos: Q92890(Tbio)
UniProt: Q92890 Q541A5
Structure
PDB: 
5C1B 2YUJ

Position
22q11.21
AA seq 307 aa
MFSFNMFDHPIPRVFQNRFSTQYRCFSVSMLAGPNDRSDVEKGGKIIMPPSALDQLSRLN
ITYPMLFKLTNKNSDRMTHCGVLEFVADEGICYLPHWMMQNLLLEEGGLVQVESVNLQVA
TYSKFQPQSPDFLDITNPKAVLENALRNFACLTTGDVIAINYNEKIYELRVMETKPDKAV
SIIECDMNVDFDAPLGYKEPERQVQHEESTEGEADHSGYAGELGFRAFSGSGNRLDGKKK
GVEPSPSPIKPGDIKRGIPNYEFKLGKITFIRNSRPLVKKVEEDEAGGRFVAFSGEGQSL
RKKGRKP
NT seq 924 nt   +upstreamnt  +downstreamnt
atgttctctttcaacatgttcgaccaccctattcccagggtcttccaaaaccgcttctcc
acacagtaccgctgcttctctgtgtccatgctagcagggcctaatgacaggtcagatgtg
gagaaaggagggaagataattatgccaccctcggccctggaccaactcagccgacttaac
attacctatcccatgctgttcaaactgaccaataagaattcggaccgcatgacgcattgt
ggcgtgctggagtttgtggctgatgagggcatctgctacctcccacactggatgatgcag
aacttactcttggaagaaggcggcctggtccaggtggagagcgtcaaccttcaagtggcc
acctactccaaattccaacctcagagccctgacttcctggacatcaccaaccccaaagcc
gtattagaaaacgcacttaggaactttgcctgtctgaccaccggggatgtgattgccatc
aactataatgaaaagatctacgaactgcgtgtgatggagaccaaacccgacaaggcagtg
tccatcattgagtgtgacatgaacgtggactttgatgctcccctgggctacaaagaaccc
gaaagacaagtccagcatgaggagtcgacagaaggtgaagccgaccacagtggctatgct
ggagagctgggcttccgcgctttctctggatctggcaatagactggatggaaagaagaaa
ggggtagagcccagcccctccccaatcaagcctggagatattaaaagaggaattcccaat
tatgaatttaaacttggtaagataactttcatcagaaattcacgtccccttgtcaaaaag
gttgaagaggatgaagctggaggcagattcgtcgctttctctggagaaggacagtcattg
cgtaaaaagggaagaaagccctaa

DBGET integrated database retrieval system