KEGG   Homo sapiens (human): 7355Help
Entry
7355              CDS       T01001                                 

Gene name
SLC35A2, CDG2M, CDGX, UDP-Gal-Tr, UGALT, UGAT, UGT, UGT1, UGT2, UGTL
Definition
(RefSeq) solute carrier family 35 member A2
  KO
K15272  solute carrier family 35 (UDP-sugar transporter), member A1/2/3
Organism
hsa  Homo sapiens (human)
Disease
H00119  Congenital disorders of glycosylation type II
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    7355 (SLC35A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC35: Nucleoside-sugar transporter
   7355 (SLC35A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nuc_sug_transp EamA TPT PUNUT
Motif
Other DBs
NCBI-GeneID: 7355
NCBI-ProteinID: NP_005651
OMIM: 314375
HGNC: 11022
Ensembl: ENSG00000102100
Vega: OTTHUMG00000024129
Pharos: P78381(Tbio)
UniProt: P78381
Position
Xp11.23
AA seq 396 aa AA seqDB search
MAAVGAGGSTAAPGPGAVSAGALEPGTASAAHRRLKYISLAVLVVQNASLILSIRYARTL
PGDRFFATTAVVMAEVLKGLTCLLLLFAQKRGNVKHLVLFLHEAVLVQYVDTLKLAVPSL
IYTLQNNLQYVAISNLPAATFQVTYQLKILTTALFSVLMLNRSLSRLQWASLLLLFTGVA
IVQAQQAGGGGPRPLDQNPGAGLAAVVASCLSSGFAGVYFEKILKGSSGSVWLRNLQLGL
FGTALGLVGLWWAEGTAVATRGFFFGYTPAVWGVVLNQAFGGLLVAVVVKYADNILKGFA
TSLSIVLSTVASIRLFGFHVDPLFALGAGLVIGAVYLYSLPRGAAKAIASASASASGPCV
HQQPPGQPPPPQLSSHRGDLITEPFLPKLLTKVKGS
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggcagcggttggggctggtggttccaccgcggcgcccgggccaggggcggtttccgcg
ggtgcattggagccggggaccgccagtgcggctcacaggcgcctgaagtacatatcccta
gctgtgctggtggtccagaatgcctccctcatcctcagcatccgctacgcccgcacgttg
ccaggggaccgcttctttgccaccactgctgtggtcatggcggaagtgctcaaaggtctc
acctgcctgctgctgctcttcgcacagaagaggggtaacgtgaagcacctggttctcttc
ctccatgaggctgtcctggtgcagtatgtggacacgctcaagctcgcagtgccctctctc
atctacaccttgcagaataacctccagtatgttgccatctctaacctaccagctgccact
ttccaggtgacataccagctgaagatcctgaccacagcgctgttctccgtgctcatgctg
aatcgcagcctttcccggctgcagtgggcctccctgctgctcctcttcactggcgtcgcc
attgtccaggcacagcaagccggtgggggaggcccacggccactggatcagaaccctggg
gcaggcctggcagccgtcgtggcctcctgtctctcctccggcttcgcaggtgtctacttt
gagaagatcctcaaaggcagctcaggctccgtgtggctgcgcaacctgcaactgggcctc
ttcggcacagcactgggcctggtggggctctggtgggctgagggtaccgccgtggccacc
cgtggtttcttttttgggtacacacctgctgtctggggcgtggtgctcaaccaggccttc
ggcgggctactggtggctgtggttgtcaagtacgctgacaatatcctcaagggctttgcc
acctccctgtccattgtgctgtccactgttgcctccattcgcctctttggcttccacgtg
gacccattatttgcccttggcgctggactcgtcattggtgctgtctacctctacagcctt
ccccgaggtgcagccaaagccatagcctctgcctctgcctccgcctccgggccctgcgtt
caccagcagcctcccgggcagccaccaccaccgcagctgtcttcccaccgtggagacctc
atcacggagccctttctgccaaagttgctcaccaaggtgaagggttcctag

DBGET integrated database retrieval system