KEGG   Homo sapiens (human): 7363Help
Entry
7363              CDS       T01001                                 

Gene name
UGT2B4, HLUG25, UDPGT2B4, UDPGTH1, UDPGTh-1, UGT2B11
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B4
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04976  Bile secretion
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7363 (UGT2B4)
   00053 Ascorbate and aldarate metabolism
    7363 (UGT2B4)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7363 (UGT2B4)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7363 (UGT2B4)
   00860 Porphyrin and chlorophyll metabolism
    7363 (UGT2B4)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7363 (UGT2B4)
   00982 Drug metabolism - cytochrome P450
    7363 (UGT2B4)
   00983 Drug metabolism - other enzymes
    7363 (UGT2B4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    7363 (UGT2B4)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    7363 (UGT2B4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7363 (UGT2B4)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7363 (UGT2B4)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7363 (UGT2B4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4 Glyco_trans_4_4 Pro_3_hydrox_C
Motif
Other DBs
NCBI-GeneID: 7363
NCBI-ProteinID: NP_066962
OMIM: 600067
HGNC: 12553
Ensembl: ENSG00000156096
Vega: OTTHUMG00000058891
Pharos: P06133(Tbio)
UniProt: P06133
Position
4q13.3
AA seq 528 aa AA seqDB search
MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSA
SISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFN
DILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAI
EKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVL
GRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSG
ENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTM
SSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaaatggacttcagctcttctgctgatacagctgagctgttactttagctct
gggagttgtggaaaggtgctggtgtggcccacagaattcagccactggatgaatataaag
acaatcctggatgaacttgtccagagaggtcatgaggtgactgtattggcatcttcagct
tccatttctttcgatcccaacagcccatctactcttaaatttgaagtttatcctgtatct
ttaactaaaactgagtttgaggatattatcaagcagctggttaagagatgggcagaactt
ccaaaagacacattttggtcatatttttcacaagtacaagaaatcatgtggacatttaat
gacatacttagaaagttctgtaaggatatagtttcaaataagaaacttatgaagaaacta
caggagtcaagatttgatgttgttcttgcagatgctgttttcccctttggtgagctgctg
gccgagttacttaaaataccctttgtctacagcctccgcttctctcctggctacgcaatt
gaaaagcatagtggaggacttctgttccctccttcctatgtgcctgttgttatgtcagaa
ctaagtgaccaaatgactttcatagagagggtaaaaaatatgatctatgtgctttatttt
gaattttggttccaaatatttgacatgaagaagtgggatcagttctacagtgaagttcta
ggaagacccactacgttatctgagacaatggcaaaagctgacatatggcttattcgaaac
tactgggattttcaatttcctcacccactcttaccaaatgttgagttcgttggaggactc
cactgcaaacctgccaaacccctaccgaaggaaatggaagagtttgtccagagctctgga
gaaaatggtgttgtggtgttttctctggggtcgatggtcagtaacacgtcagaagaaagg
gccaatgtaattgcatcagcccttgccaagatcccacaaaaggttctgtggagatttgat
gggaataaaccagatactttaggactcaatactcggctgtacaagtggataccccagaat
gatcttcttggtcacccaaaaaccagagcttttataactcatggtggagccaatggcatc
tatgaggcaatctaccatggaatccctatggtgggcgttccattgtttgcagatcaacct
gataacattgcacacatgaaggccaagggagcagctgttagtttggacttccacacaatg
tcgagtacagacttactcaatgcactgaagacagtaattaatgatcctttatataaagag
aatgctatgaaattatcaagaattcatcatgatcaaccagtgaagccccttgatcgagca
gtcttctggattgaatttgtcatgcgccataaaggagccaagcaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgactgggttcctgctggcctgt
gtggcaactgtgatattcatcatcacaaaatgtctgttttgtgtctggaagtttgttaga
acaggaaagaaggggaaaagagattaa

DBGET integrated database retrieval system