KEGG   Homo sapiens (human): 7364Help
Entry
7364              CDS       T01001                                 

Gene name
UGT2B7, UDPGT_2B7, UDPGT_2B9, UDPGT2B7, UDPGTH2, UDPGTh-2, UGT2B9
Definition
(RefSeq) UDP glucuronosyltransferase family 2 member B7
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00040  Pentose and glucuronate interconversions
hsa00053  Ascorbate and aldarate metabolism
hsa00140  Steroid hormone biosynthesis
hsa00830  Retinol metabolism
hsa00860  Porphyrin and chlorophyll metabolism
hsa00980  Metabolism of xenobiotics by cytochrome P450
hsa00982  Drug metabolism - cytochrome P450
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa05204  Chemical carcinogenesis
Module
hsa_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    7364 (UGT2B7)
   00053 Ascorbate and aldarate metabolism
    7364 (UGT2B7)
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    7364 (UGT2B7)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    7364 (UGT2B7)
   00860 Porphyrin and chlorophyll metabolism
    7364 (UGT2B7)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    7364 (UGT2B7)
   00982 Drug metabolism - cytochrome P450
    7364 (UGT2B7)
   00983 Drug metabolism - other enzymes
    7364 (UGT2B7)
 09160 Human Diseases
  09161 Cancers: Overview
   05204 Chemical carcinogenesis
    7364 (UGT2B7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:hsa01003]
    7364 (UGT2B7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     7364 (UGT2B7)
Glycosyltransferases [BR:hsa01003]
 Others
  Hydrophobic molecule
   7364 (UGT2B7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT Glyco_tran_28_C Glyco_transf_4
Motif
Other DBs
NCBI-GeneID: 7364
NCBI-ProteinID: NP_001065
OMIM: 600068
HGNC: 12554
Ensembl: ENSG00000171234
Vega: OTTHUMG00000129404
Pharos: P16662(Tchem)
UniProt: P16662
Structure
PDB: 

Position
4q13.2
AA seq 529 aa AA seqDB search
MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSA
SILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFG
DITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTF
EKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVL
GRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSG
ENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQN
DLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTM
SSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAA
HDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtgaaatggacttcagtaattttgctaatacaactgagcttttgctttagctct
gggaattgtggaaaggtgctggtgtgggcagcagaatacagccattggatgaatataaag
acaatcctggatgagcttattcagagaggtcatgaggtgactgtactggcatcttcagct
tccattctttttgatcccaacaactcatccgctcttaaaattgaaatttatcccacatct
ttaactaaaactgagttggagaatttcatcatgcaacagattaagagatggtcagacctt
ccaaaagatacattttggttatatttttcacaagtacaggaaatcatgtcaatatttggt
gacataactagaaagttctgtaaagatgtagtttcaaataagaaatttatgaaaaaagta
caagagtcaagatttgacgtcatttttgcagatgctatttttccctgtagtgagctgctg
gctgagctatttaacataccctttgtgtacagtctcagcttctctcctggctacactttt
gaaaagcatagtggaggatttattttccctccttcctacgtacctgttgttatgtcagaa
ttaactgatcaaatgactttcatggagagggtaaaaaatatgatctatgtgctttacttt
gacttttggttcgaaatatttgacatgaagaagtgggatcagttttatagtgaagttcta
ggaagacccactacattatctgagacaatggggaaagctgacgtatggcttattcgaaac
tcctggaattttcagtttccatatccactcttaccaaatgttgattttgttggaggactc
cactgcaaacctgccaaacccctgcctaaggaaatggaagactttgtacagagctctgga
gaaaatggtgttgtggtgttttctctggggtcaatggtcagtaacatgacagaagaaagg
gccaacgtaattgcatcagccctggcccagatcccacaaaaggttctgtggagatttgat
gggaataaaccagataccttaggtctcaatactcggctctacaagtggataccccagaat
gaccttctaggtcatccaaagaccagagcttttataactcatggtggagccaatggcatc
tacgaggcaatctaccatgggatccctatggtggggattccattgtttgccgatcaacct
gataacattgctcacatgaaggccaggggagcagctgttagagtggacttcaacacaatg
tcgagtacagacttgctgaatgcattgaagagagtaattaatgatccttcatataaagag
aatgttatgaaattatcaagaattcaacatgatcaaccagtgaagcccctggatcgagca
gtcttctggattgaatttgtcatgcgccacaaaggagctaaacaccttcgggttgcagcc
cacgacctcacctggttccagtaccactctttggatgtgattgggttcctgctggtctgt
gtggcaactgtgatatttatcgtcacaaaatgttgtctgttttgtttctggaagtttgct
agaaaagcaaagaagggaaaaaatgattag

DBGET integrated database retrieval system