KEGG   Homo sapiens (human): 7374Help
Entry
7374              CDS       T01001                                 

Gene name
UNG, DGU, HIGM4, HIGM5, UDG, UNG1, UNG15, UNG2
Definition
(RefSeq) uracil DNA glycosylase
  KO
K03648  uracil-DNA glycosylase [EC:3.2.2.27]
Organism
hsa  Homo sapiens (human)
Pathway
hsa03410  Base excision repair
hsa05340  Primary immunodeficiency
Disease
H00086  Hyper IgM syndromes, autosomal recessive type
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    7374 (UNG)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    7374 (UNG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7374 (UNG)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     7374 (UNG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     7374 (UNG)
 Prokaryotic Type
     7374 (UNG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDG Toxin_ToxA
Motif
Other DBs
NCBI-GeneID: 7374
NCBI-ProteinID: NP_550433
OMIM: 191525
HGNC: 12572
Ensembl: ENSG00000076248
Vega: OTTHUMG00000169247
Pharos: P13051(Tbio)
UniProt: P13051 E5KTA5
Structure
PDB: 

Position
12q24.11
AA seq 313 aa AA seqDB search
MIGQKTLYSFFSPSPARKRHAPSPEPAVQGTGVAGVPEESGDAAAIPAKKAPAGQEEPGT
PPSSPLSAEQLDRIQRNKAAALLRLAARNVPVGFGESWKKHLSGEFGKPYFIKLMGFVAE
ERKHYTVYPPPHQVFTWTQMCDIKDVKVVILGQDPYHGPNQAHGLCFSVQRPVPPPPSLE
NIYKELSTDIEDFVHPGHGDLSGWAKQGVLLLNAVLTVRAHQANSHKERGWEQFTDAVVS
WLNQNSNGLVFLLWGSYAQKKGSAIDRKRHHVLQTAHPSPLSVYRGFFGCRHFSKTNELL
QKSGKKPIDWKEL
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgatcggccagaagacgctctactcctttttctcccccagccccgccaggaagcgacac
gcccccagccccgagccggccgtccaggggaccggcgtggctggggtgcctgaggaaagc
ggagatgcggcggccatcccagccaagaaggccccggctgggcaggaggagcctgggacg
ccgccctcctcgccgctgagtgccgagcagttggaccggatccagaggaacaaggccgcg
gccctgctcagactcgcggcccgcaacgtgcccgtgggctttggagagagctggaagaag
cacctcagcggggagttcgggaaaccgtattttatcaagctaatgggatttgttgcagaa
gaaagaaagcattacactgtttatccacccccacaccaagtcttcacctggacccagatg
tgtgacataaaagatgtgaaggttgtcatcctgggacaggatccatatcatggacctaat
caagctcacgggctctgctttagtgttcaaaggcctgttccgcctccgcccagtttggag
aacatttataaagagttgtctacagacatagaggattttgttcatcctggccatggagat
ttatctgggtgggccaagcaaggtgttctccttctcaacgctgtcctcacggttcgtgcc
catcaagccaactctcataaggagcgaggctgggagcagttcactgatgcagttgtgtcc
tggctaaatcagaactcgaatggccttgttttcttgctctggggctcttatgctcagaag
aagggcagtgccattgataggaagcggcaccatgtactacagacggctcatccctcccct
ttgtcagtgtatagagggttctttggatgtagacacttttcaaagaccaatgagctgctg
cagaagtctggcaagaagcccattgactggaaggagctgtga

DBGET integrated database retrieval system