KEGG   Homo sapiens (human): 7376Help
Entry
7376              CDS       T01001                                 

Gene name
NR1H2, LXR-b, LXRB, NER, NER-I, RIP15, UNR
Definition
(RefSeq) nuclear receptor subfamily 1 group H member 2
  KO
K08535  liver X receptor beta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04931  Insulin resistance
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09166 Endocrine and metabolic diseases
   04931 Insulin resistance
    7376 (NR1H2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7376 (NR1H2)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    7376 (NR1H2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7376 (NR1H2)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1H. Liver X receptor like receptor
   7376 (NR1H2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4
Motif
Other DBs
NCBI-GeneID: 7376
NCBI-ProteinID: NP_009052
OMIM: 600380
HGNC: 7965
Ensembl: ENSG00000131408
Vega: OTTHUMG00000183036
Pharos: P55055(Tchem)
UniProt: P55055 F1D8P7
Structure
PDB: 

Position
19q13.33
AA seq 461 aa AA seqDB search
MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDW
VIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGA
RRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQS
QSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNK
RSFSDQPKVTPWPLGADPQSRDARQQRFAHFTELAIISVQEIVDFAKQVPGFLQLGREDQ
IALLKASTIEIMLLETARRYNHETECITFLKDFTYSKDDFHRAGLQVEFINPIFEFSRAM
RRLGLDDAEYALLIAINIFSADRPNVQEPGRVEALQQPYVEALLSYTRIKRPQDQLRFPR
MLMKLVSLRTLSSVHSEQVFALRLQDKKLPPLLSEIWDVHE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgtcctctcctaccacgagttccctggatacccccctgcctggaaatggcccccctcag
cctggcgccccttcttcttcacccactgtaaaggaggagggtccggagccgtggcccggg
ggtccggaccctgatgtcccaggcactgatgaggccagctcagcctgcagcacagactgg
gtcatcccagatcccgaagaggaaccagagcgcaagcgaaagaagggcccagccccgaag
atgctgggccacgagctttgccgtgtctgtggggacaaggcctccggcttccactacaac
gtgctcagctgcgaaggctgcaagggcttcttccggcgcagtgtggtccgtggtggggcc
aggcgctatgcctgccggggtggcggaacctgccagatggacgctttcatgcggcgcaag
tgccagcagtgccggctgcgcaagtgcaaggaggcagggatgagggagcagtgcgtcctt
tctgaagaacagatccggaagaagaagattcggaaacaacagcagcaggagtcacagtca
cagtcgcagtcacctgtggggccgcagggcagcagcagctcagcctctgggcctggggct
tcccctggtggatctgaggcaggcagccagggctccggggaaggcgagggtgtccagcta
acagcggctcaagaactaatgatccagcagttggtggcggcccaactgcagtgcaacaaa
cgctccttctccgaccagcccaaagtcacgccctggcccctgggcgcagacccccagtcc
cgagatgcccgccagcaacgctttgcccacttcacggagctggccatcatctcagtccag
gagatcgtggacttcgctaagcaagtgcctggtttcctgcagctgggccgggaggaccag
atcgccctcctgaaggcatccactatcgagatcatgctgctagagacagccaggcgctac
aaccacgagacagagtgtatcaccttcttgaaggacttcacctacagcaaggacgacttc
caccgtgcaggcctgcaggtggagttcatcaaccccatcttcgagttctcgcgggccatg
cggcggctgggcctggacgacgctgagtacgccctgctcatcgccatcaacatcttctcg
gccgaccggcccaacgtgcaggagccgggccgcgtggaggcgttgcagcagccctacgtg
gaggcgctgctgtcctacacgcgcatcaagaggccgcaggaccagctgcgcttcccgcgc
atgctcatgaagctggtgagcctgcgcacgctgagctctgtgcactcggagcaggtcttc
gccttgcggctccaggacaagaagctgccgcctctgctgtcggagatctgggacgtccac
gagtga

DBGET integrated database retrieval system