KEGG   Homo sapiens (human): 7378Help
Entry
7378              CDS       T01001                                 

Gene name
UPP1, UDRPASE, UP, UPASE, UPP
Definition
(RefSeq) uridine phosphorylase 1
  KO
K00757  uridine phosphorylase [EC:2.4.2.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00240  Pyrimidine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    7378 (UPP1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7378 (UPP1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.3  uridine phosphorylase
     7378 (UPP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PNP_UDP_1
Motif
Other DBs
NCBI-GeneID: 7378
NCBI-ProteinID: NP_001274355
OMIM: 191730
HGNC: 12576
Ensembl: ENSG00000183696
Vega: OTTHUMG00000129253
Pharos: Q16831(Tchem)
UniProt: Q16831 B4DND0
Structure
PDB: 

Position
7p12.3
AA seq 310 aa AA seqDB search
MAATGANAEKAESHNDCPVRLLNPNIAKMKEDILYHFNLTTSRHNFPALFGDVKFVCVGG
SPSRMKAFIRCVGAELGLDCPGRDYPNICAGTDRYAMYKVGPVLSVSHGMGIPSISIMLH
ELIKLLYYARCSNVTIIRIGTSGGIGLEPGTVVITEQAVDTCFKAEFEQIVLGKRVIRKT
DLNKKLVQELLLCSAELSEFTTVVGNTMCTLDFYEGQGRLDGALCSYTEKDKQAYLEAAY
AAGVRNIEMESSVFAAMCSACGLQAAVVCVTLLNRLEGDQISSPRNVLSEYQQRPQRLVS
YFIKKKLSKA
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggcggccacgggagccaatgcagagaaagctgaaagtcacaatgattgccccgtcaga
cttttaaatccaaacatagcaaaaatgaaagaagatattctctatcatttcaatctcacc
actagcagacacaatttcccagccttgtttggagatgtgaagtttgtgtgtgttggtgga
agcccctcccggatgaaagccttcatcaggtgcgttggtgcagagctgggccttgactgc
ccaggtagagactatcccaacatctgtgcgggaactgaccgctatgccatgtataaagta
ggaccggtgctgtctgtcagtcatggtatgggcattccttctatctcaatcatgttgcat
gagctcataaagctgctgtactatgcccggtgctccaacgtcactatcatccgcattggc
acttctggtgggataggtctggagcccggcactgtggtcataacagagcaggcagtggat
acctgcttcaaggcagagtttgagcagattgtcctggggaagcgggtcatccggaaaacg
gaccttaacaagaagctggtgcaggagctgttgctgtgttctgcagagctgagcgagttc
accacagtggtggggaacaccatgtgcaccttggacttctatgaagggcaaggccgtctg
gatggggctctctgctcctacacggagaaggacaagcaggcgtatctggaggcagcctat
gcagccggcgtccgcaatatcgagatggagtcctcggtgtttgccgccatgtgcagcgcc
tgcggcctccaagcggccgtggtgtgtgtcaccctcctgaaccgcctggaaggggaccag
atcagcagccctcgcaatgtgctcagcgagtaccagcagaggccgcagcggctggtgagc
tacttcatcaagaagaaactgagcaaggcctga

DBGET integrated database retrieval system