KEGG   Homo sapiens (human): 7384Help
Entry
7384              CDS       T01001                                 

Gene name
UQCRC1, D3S3191, QCR1, UQCR1
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05016  Huntington disease
Module
hsa_M00152  Cytochrome bc1 complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7384 (UQCRC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7384 (UQCRC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7384 (UQCRC1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    7384 (UQCRC1)
   05012 Parkinson disease
    7384 (UQCRC1)
   05016 Huntington disease
    7384 (UQCRC1)
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7384 (UQCRC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    7384 (UQCRC1)
Peptidases [BR:hsa01002]
 Metallo Peptidases
  Family M16: pitrilysin family
   7384 (UQCRC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Motif
Other DBs
NCBI-GeneID: 7384
NCBI-ProteinID: NP_003356
OMIM: 191328
HGNC: 12585
Ensembl: ENSG00000010256
Vega: OTTHUMG00000133539
Pharos: P31930(Tbio)
UniProt: P31930
Structure
PDB: 

Position
3p21.31
AA seq 480 aa AA seqDB search
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtccgtggtctgtcgggccgctaccgccggggcacaagtgctattgcgcgcc
cgccgctcgccggccctgctgcggacgccagccttgcggagtacggcaaccttcgctcag
gcgctccagttcgtgccggagacgcaggttagcctgctggacaacggcctgcgtgtggcc
tccgagcagtcctctcagcccacttgcacggtgggagtgtggattgatgttggcagccgt
tttgagactgagaagaataatggggcaggctactttttggagcatctggctttcaaggga
acaaagaatcggcctggcagtgccctggagaaggaggtggagagcatgggggcccatctt
aatgcctacagcacccgggagcacacagcttactacatcaaggcgctgtccaaggatctg
ccgaaagctgtggagctcctgggtgacattgtgcagaactgtagtctggaagactcacag
attgagaaggaacgtgatgtgatcctgcgggagatgcaggagaatgatgcatctatgcga
gatgtggtctttaactacctgcatgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaatgtcaggaagctgtctcgtgcagacttgaccgagtacctc
agcacacattacaaggcccctcgaatggtgctggcagcagctggaggagtggagcaccag
caactgttagacctcgcccagaagcacctcggtggcatcccatggacatatgcagaggac
gctgtgcccactcttactccatgccgcttcactggcagtgagatccgccaccgtgatgat
gctctaccttttgcccacgtggccattgcagtagagggtcctggctgggccagcccggac
aatgtggccttgcaagtggccaatgccatcatcggccactatgactgcacttatggtggt
ggcgtgcacctgtccagcccactggcttcaggtgctgtggccaacaagctatgccagagt
ttccagaccttcagcatctgctatgcagagacgggcttgctgggtgcacactttgtctgt
gaccgaatgaaaatcgatgacatgatgttcgtcctgcaagggcagtggatgcgcctgtgt
accagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccctggta
tctcatctagatggcactactcctgtgtgtgaggacatcggacgcagcctcctgacctat
ggccgccgcatccccctggctgaatgggaaagccggattgcggaggtggatgccagtgtg
gtacgtgagatctgctccaagtacatctatgaccagtgcccagcagtggctggatatggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgcttc
tag

DBGET integrated database retrieval system