KEGG   Homo sapiens (human): 7384
Entry
7384              CDS       T01001                                 

Gene name
UQCRC1, D3S3191, QCR1, UQCR1
Definition
(RefSeq) ubiquinol-cytochrome c reductase core protein 1
  KO
K00414  ubiquinol-cytochrome c reductase core subunit 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa00190  Oxidative phosphorylation
hsa01100  Metabolic pathways
hsa04260  Cardiac muscle contraction
hsa04714  Thermogenesis
hsa04932  Non-alcoholic fatty liver disease
hsa05010  Alzheimer disease
hsa05012  Parkinson disease
hsa05014  Amyotrophic lateral sclerosis
hsa05016  Huntington disease
hsa05020  Prion disease
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05415  Diabetic cardiomyopathy
Module
hsa_M00152  Cytochrome bc1 complex
Network
nt06418  Oxidative phosphorylation
nt06461  Huntington disease
nt06463  Parkinson disease
  Element
N00990  Electron transfer in Complex III
N00991  Mutation-caused aberrant Htt to electron transfer in Complex III
N01046  Maneb to electron transfer in Complex III
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    7384 (UQCRC1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    7384 (UQCRC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    7384 (UQCRC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    7384 (UQCRC1)
   05012 Parkinson disease
    7384 (UQCRC1)
   05014 Amyotrophic lateral sclerosis
    7384 (UQCRC1)
   05016 Huntington disease
    7384 (UQCRC1)
   05020 Prion disease
    7384 (UQCRC1)
   05022 Pathways of neurodegeneration - multiple diseases
    7384 (UQCRC1)
  09166 Cardiovascular disease
   05415 Diabetic cardiomyopathy
    7384 (UQCRC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    7384 (UQCRC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7384 (UQCRC1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M16: pitrilysin family
   7384 (UQCRC1)
SSDB
Motif
Pfam: Peptidase_M16 Peptidase_M16_C M16C_assoc
Other DBs
NCBI-GeneID: 7384
NCBI-ProteinID: NP_003356
OMIM: 191328
HGNC: 12585
Ensembl: ENSG00000010256
Vega: OTTHUMG00000133539
Pharos: P31930(Tbio)
UniProt: P31930
Structure
PDB: 
5XTE

Position
3p21.31
AA seq 480 aa
MAASVVCRAATAGAQVLLRARRSPALLRTPALRSTATFAQALQFVPETQVSLLDNGLRVA
SEQSSQPTCTVGVWIDVGSRFETEKNNGAGYFLEHLAFKGTKNRPGSALEKEVESMGAHL
NAYSTREHTAYYIKALSKDLPKAVELLGDIVQNCSLEDSQIEKERDVILREMQENDASMR
DVVFNYLHATAFQGTPLAQAVEGPSENVRKLSRADLTEYLSTHYKAPRMVLAAAGGVEHQ
QLLDLAQKHLGGIPWTYAEDAVPTLTPCRFTGSEIRHRDDALPFAHVAIAVEGPGWASPD
NVALQVANAIIGHYDCTYGGGVHLSSPLASGAVANKLCQSFQTFSICYAETGLLGAHFVC
DRMKIDDMMFVLQGQWMRLCTSATESEVARGKNILRNALVSHLDGTTPVCEDIGRSLLTY
GRRIPLAEWESRIAEVDASVVREICSKYIYDQCPAVAGYGPIEQLPDYNRIRSGMFWLRF
NT seq 1443 nt   +upstreamnt  +downstreamnt
atggcggcgtccgtggtctgtcgggccgctaccgccggggcacaagtgctattgcgcgcc
cgccgctcgccggccctgctgcggacgccagccttgcggagtacggcaaccttcgctcag
gcgctccagttcgtgccggagacgcaggttagcctgctggacaacggcctgcgtgtggcc
tccgagcagtcctctcagcccacttgcacggtgggagtgtggattgatgttggcagccgt
tttgagactgagaagaataatggggcaggctactttttggagcatctggctttcaaggga
acaaagaatcggcctggcagtgccctggagaaggaggtggagagcatgggggcccatctt
aatgcctacagcacccgggagcacacagcttactacatcaaggcgctgtccaaggatctg
ccgaaagctgtggagctcctgggtgacattgtgcagaactgtagtctggaagactcacag
attgagaaggaacgtgatgtgatcctgcgggagatgcaggagaatgatgcatctatgcga
gatgtggtctttaactacctgcatgccacagcattccagggcacacctctagcccaggct
gtggaggggcccagtgagaatgtcaggaagctgtctcgtgcagacttgaccgagtacctc
agcacacattacaaggcccctcgaatggtgctggcagcagctggaggagtggagcaccag
caactgttagacctcgcccagaagcacctcggtggcatcccatggacatatgcagaggac
gctgtgcccactcttactccatgccgcttcactggcagtgagatccgccaccgtgatgat
gctctaccttttgcccacgtggccattgcagtagagggtcctggctgggccagcccggac
aatgtggccttgcaagtggccaatgccatcatcggccactatgactgcacttatggtggt
ggcgtgcacctgtccagcccactggcttcaggtgctgtggccaacaagctatgccagagt
ttccagaccttcagcatctgctatgcagagacgggcttgctgggtgcacactttgtctgt
gaccgaatgaaaatcgatgacatgatgttcgtcctgcaagggcagtggatgcgcctgtgt
accagtgccacggagagtgaggtggcccggggcaaaaacatcctcagaaatgccctggta
tctcatctagatggcactactcctgtgtgtgaggacatcggacgcagcctcctgacctat
ggccgccgcatccccctggctgaatgggaaagccggattgcggaggtggatgccagtgtg
gtacgtgagatctgctccaagtacatctatgaccagtgcccagcagtggctggatatggc
cccattgagcagctcccagactacaaccggatccgtagcggcatgttctggctgcgcttc
tag

DBGET integrated database retrieval system