KEGG   Homo sapiens (human): 7389
Entry
7389              CDS       T01001                                 

Gene name
UROD, PCT, UPD
Definition
(RefSeq) uroporphyrinogen decarboxylase
  KO
K01599  uroporphyrinogen decarboxylase [EC:4.1.1.37]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00860  Porphyrin and chlorophyll metabolism
hsa01100  Metabolic pathways
hsa01240  Biosynthesis of cofactors
Module
hsa_M00868  Heme biosynthesis, animals and fungi, glycine => heme
Network
nt06011  Heme biosynthesis
  Element
N00601  Heme biosynthesis
N00602  FECH deficiency in heme biosynthesis
N00603  PPOX deficiency in heme biosynthesis
N00604  CPOX deficiency in heme biosynthesis
N00605  UROD deficiency in heme biosynthesis
Disease
H00201  Erythropoietic porphyria
H00202  Hepatic porphyria
H01763  Porphyria
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    7389 (UROD)
Enzymes [BR:hsa01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.37  uroporphyrinogen decarboxylase
     7389 (UROD)
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-GeneID: 7389
NCBI-ProteinID: NP_000365
OMIM: 613521
HGNC: 12591
Ensembl: ENSG00000126088
Vega: OTTHUMG00000008949
Pharos: P06132(Tbio)
UniProt: P06132
Structure
PDB: 

Position
1p34.1
AA seq 367 aa
MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCR
SPEACCELTLQPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLER
LRDPEVVASELGYVFQAITLTRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRW
LYQRPQASHQLLRILTDALVPYLVGQVVAGAQALQLFESHAGHLGPQLFNKFALPYIRDV
AKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVVGLDWTVAPKKARECVGKTVT
LQGNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHVGAFVDAVHKH
SRLLRQN
NT seq 1104 nt   +upstreamnt  +downstreamnt
atggaagcgaatgggttgggacctcagggttttccggagctgaagaatgacacattcctg
cgagcagcctggggagaggaaacagactacactcccgtttggtgcatgcgccaggcaggc
cgttacttaccagagtttagggaaacccgggctgcccaggactttttcagcacgtgtcgc
tctcctgaggcctgctgtgaactgactctgcagccactgcgtcgcttccctctggatgct
gccatcattttctccgacatccttgttgtaccccaggcactgggcatggaggtgaccatg
gtacctggcaaaggacccagcttcccagagccattaagagaagagcaggacctagaacgc
ctacgggatccagaagtggtagcctctgagctaggctatgtgttccaagccatcaccctt
acccgacaacgactggctggacgtgtgccgctgattggctttgctggtgccccatggacc
ctgatgacatacatggttgagggtggtggctcaagcaccatggctcaggccaagcgctgg
ctctatcagagacctcaggctagtcaccagctgcttcgcatcctcactgatgctctggtc
ccatatctggtaggacaagtggtggctggtgcccaggcattgcagctgtttgagtcccat
gcagggcatcttggcccacagctcttcaacaagtttgcactgccttacatccgtgatgtg
gccaagcaagtgaaggccaggttgcgggaggcaggcctggcaccagtgcccatgatcatc
tttgctaaggatgggcattttgccctggaggagctggcccaagctggctatgaggtggtt
gggcttgactggacagtggccccaaagaaagcccgggagtgtgtggggaagacggtgaca
ttgcagggcaacctggacccctgtgccttgtatgcatctgaggaggagatcgggcagttg
gtgaagcagatgctggatgactttggaccacatcgctacattgccaacctgggccatggg
ctttatcctgacatggacccagaacatgtgggcgcctttgtggatgctgtgcataaacac
tcacgtctgcttcgacagaactga

DBGET integrated database retrieval system