KEGG   Homo sapiens (human): 7404Help
Entry
7404              CDS       T01001                                 

Gene name
UTY, KDM6AL, KDM6C, UTY1
Definition
(RefSeq) ubiquitously transcribed tetratricopeptide repeat containing, Y-linked
  KO
K11447  histone demethylase [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    7404 (UTY)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    7404 (UTY)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     7404 (UTY)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   HMT complexes
    MLL3/MLL4 complex
     7404 (UTY)
   Histone demethylases
    7404 (UTY)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: JmjC TPR_1 TPR_2 TPR_16 TPR_8 TPR_17 TPR_12 TPR_19 TPR_9 TPR_11 TPR_15 ANAPC3
Motif
Other DBs
NCBI-GeneID: 7404
NCBI-ProteinID: NP_009056
OMIM: 400009
HGNC: 12638
Ensembl: ENSG00000183878
Vega: OTTHUMG00000036319
Pharos: O14607(Tbio)
UniProt: O14607
Structure
PDB: 

Position
Yq11.221
AA seq 1347 aa AA seqDB search
MKSCAVSLTTAAVAFGDEAKKMAEGKASRESEEESVSLTVEEREALGGMDSRLFGFVRLH
EDGARTKTLLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYSKALSAYQRYYSLQ
ADYWKNAAFLYGLGLVYFYYNAFHWAIKAFQDVLYVDPSFCRAKEIHLRLGLMFKVNTDY
KSSLKHFQLALIDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLPAQVKA
TVLQQLGWMHHNMDLVGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDA
FISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYE
SCNQPQDAIKCYLNAARSKRCSNTSTLAARIKFLQNGSDNWNGGQSLSHHPVQQVYSLCL
TPQKLQHLEQLRANRDNLNPAQKHQLEQLESQFVLMQQMRHKEVAQVRTTGIHNGAITDS
SLPTNSVSNRQPHGALTRVSSVSQPGVRPACVEKLLSSGAFSAGCIPCGTSKILGSTDTI
LLGSNCIAGSESNGNVPYLQQNTHTLPHNHTDLNSSTEEPWRKQLSNSAQGLHKSQSSCL
SGPNEEQPLFSTGSAQYHQATSTGIKKANEHLTLPSNSVPQGDADSHLSCHTATSGGQQG
IMFTKESKPSKNRSLVPETSRHTGDTSNGCADVKGLSNHVHQLIADAVSSPNHGDSPNLL
IADNPQLSALLIGKANGNVGTGTCDKVNNIHPAVHTKTDHSVASSPSSAISTATPSPKST
EQRSINSVTSLNSPHSGLHTVNGEGLGKSQSSTKVDLPLASHRSTSQILPSMSVSICPSS
TEVLKACRNPGKNGLSNSCILLDKCPPPRPPTSPYPPLPKDKLNPPTPSIYLENKRDAFF
PPLHQFCTNPKNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWD
PTGTKKIWRCESNRSHTTIAKYAQYQASSFQESLREENEKRTQHKDHSDNESTSSENSGR
RRKGPFKTIKFGTNIDLSDNKKWKLQLHELTKLPAFARVVSAGNLLTHVGHTILGMNTVQ
LYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEDYWGVLNDFCEKNNLNFLMSSW
WPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAVGWCNNIAWNVGPLTACQYKLAV
ERYEWNKLKSVKSPVPMVHLSWNMARNIKVSDPKLFEMIKYCLLKILKQYQTLREALVAA
GKEVIWHGRTNDEPAHYCSICEVEVFNLLFVTNESNTQKTYIVHCHDCARKTSKSLENFV
VLEQYKMEDLIQVYDQFTLALSLSSSS
NT seq 4044 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcctgcgcagtgtcgctcactaccgccgctgttgccttcggtgatgaggcaaag
aaaatggcggaaggaaaagcgagccgcgagagtgaagaggagtctgttagcctgacagtc
gaggaaagggaggcgcttggtggcatggacagccgtctcttcgggttcgtgaggcttcat
gaagatggcgccagaacgaagaccctactaggcaaggctgttcgctgctacgaatcttta
atcttaaaagctgaaggaaaagtggagtctgacttcttttgccaattaggtcacttcaac
ctcttgttggaagattattcaaaagcattatctgcatatcagagatattacagtttacag
gctgactactggaagaatgctgcgtttttatatggccttggtttggtctacttctactac
aatgcatttcattgggcaattaaagcatttcaagatgtcctttatgttgaccccagcttt
tgtcgagccaaggaaattcatttacgacttgggctcatgttcaaagtgaacacagactac
aagtctagtttaaagcattttcagttagccttgattgactgtaatccatgtactttgtcc
aatgctgaaattcaatttcatattgcccatttgtatgaaacccagaggaagtatcattct
gcaaaggaggcatatgaacaacttttgcagacagaaaaccttcctgcacaagtaaaagca
actgtattgcaacagttaggttggatgcatcataatatggatctagtaggagacaaagcc
acaaaggaaagctatgctattcagtatctccaaaagtctttggaggcagatcctaattct
ggccaatcgtggtattttcttggaaggtgttattcaagtattgggaaagttcaggatgcc
tttatatcttacaggcaatctattgataaatcagaagcaagtgcagatacatggtgttca
ataggtgtgttgtatcagcagcaaaatcagcctatggatgctttacaggcatatatttgt
gctgtacaattggaccatgggcatgccgcagcctggatggacctaggtactctctatgaa
tcctgcaatcaacctcaagatgccattaaatgctacctaaatgcagctagaagcaaacgt
tgtagtaatacctctacgcttgctgcaagaattaaatttctacagaatggttctgataac
tggaatggtggccagagtctttcacatcatccagtacagcaagtttattcgttgtgtttg
acaccacagaaattacagcacttggaacaactgcgagcaaatagagataatttaaatcca
gcacagaagcatcagctggaacagttagaaagtcagtttgtcttaatgcagcaaatgaga
cacaaagaagttgctcaggtacgaactactggaattcataacggggccataactgattca
tcactgcctacaaactctgtctctaatcgacaaccacatggtgctctgaccagagtatct
agcgtctctcagcctggagttcgccctgcttgtgttgaaaaacttttgtccagtggagct
ttttctgcaggctgtattccttgtggcacatcaaaaattctaggaagtacagacactatc
ttgctaggcagtaattgtatagcaggaagtgaaagtaatggaaatgtgccttacctgcag
caaaatacacacactctacctcataatcatacagacctgaacagcagcacagaagagcca
tggagaaaacagctatctaactccgctcaggggcttcataaaagtcagagttcatgtttg
tcaggacctaatgaagaacaacctctgttttccactgggtcagcccagtatcaccaggca
actagcactggtattaagaaggcgaatgaacatctcactctgcctagtaattcagtacca
cagggggatgctgacagtcacctctcctgtcatactgctacctcaggtggacaacaaggc
attatgtttaccaaagagagcaagccttcaaaaaatagatccttggtgcctgaaacaagc
aggcatactggagacacatctaatggctgtgctgatgtcaagggactttctaatcatgtt
catcagttgatagcagatgctgtttccagtcctaaccatggagattcaccaaatttatta
attgcagacaatcctcagctctctgctttgttgattggaaaagccaatggcaatgtgggt
actggaacctgtgacaaagtgaataatattcacccagctgttcatacaaagactgatcat
tctgttgcctcttcaccctcttcagccatttccacagcaacaccttctcctaaatccact
gagcagagaagcataaacagtgttaccagccttaacagtcctcacagtggattacacaca
gtcaatggagaggggctggggaagtcacagagctctacaaaagtagacctgcctttagct
agccacagatctacttctcagatcttaccatcaatgtcagtgtctatatgccccagttca
acagaagttctgaaagcatgcaggaatccaggtaaaaatggcttgtctaatagctgcatt
ttgttagataaatgtccacctccaagaccaccaacttcaccatacccacccttgccaaag
gacaagttgaatccacccacacctagtatttacttggaaaataaacgtgatgctttcttt
cctccattacatcaattttgtacaaatccaaaaaaccctgttacagtaatacgtggcctt
gctggagctcttaaattagatcttggacttttctctaccaaaactttggtagaagctaac
aatgaacatatggtagaagtgaggacacagttgctgcaaccagcagatgaaaactgggat
cccactggaacaaagaaaatctggcgttgtgaaagcaatagatctcatactacaattgcc
aaatacgcacaataccaggcttcctccttccaggaatcattgagagaagaaaatgagaaa
agaacacaacacaaagatcattcagataacgaatccacatcttcagagaattctggaagg
agaaggaaaggaccttttaaaaccataaaatttgggaccaacattgacctctctgataac
aaaaagtggaagttgcagttacatgaactgactaaacttcctgcttttgcgcgtgtggtg
tcagcaggaaatcttctaacccatgttgggcataccattctgggcatgaatacagtacaa
ctgtatatgaaagttccagggagtcggacaccaggtcaccaagaaaataacaacttctgc
tctgttaacataaatattggtccaggagattgtgaatggtttgttgtacctgaagattat
tggggtgttctgaatgacttctgtgaaaaaaataatttgaattttttaatgagttcttgg
tggcccaaccttgaagatctttatgaagcaaatgtccctgtgtatagatttattcagcga
cctggagatttggtctggataaatgcaggcactgtgcattgggttcaagctgttggctgg
tgcaataacattgcctggaatgttggtccacttacagcctgccagtataaattggcagtg
gaacggtatgaatggaacaaattgaaaagtgtgaagtcaccagtacccatggtgcatctt
tcctggaatatggcacgaaatatcaaagtctcagatccaaagctttttgaaatgattaag
tattgtcttttgaaaattctgaagcaatatcagacattgagagaagctcttgttgcagca
ggaaaagaggttatatggcatgggcggacaaatgatgaaccagctcattactgtagcatt
tgtgaggtggaggtttttaatctgctttttgtcactaatgaaagcaatactcaaaaaacc
tacatagtacattgccatgattgtgcacgaaaaacaagcaaaagtttggaaaattttgtg
gtgctcgaacagtacaaaatggaggacctaatccaagtttatgatcaatttacactagct
ctttcattatcatcctcatcttga

DBGET integrated database retrieval system