KEGG   Homo sapiens (human): 7412Help
Entry
7412              CDS       T01001                                 

Gene name
VCAM1, CD106, INCAM-100
Definition
(RefSeq) vascular cell adhesion molecule 1
  KO
K06527  vascular cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04064  NF-kappa B signaling pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04668  TNF signaling pathway
hsa04670  Leukocyte transendothelial migration
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05143  African trypanosomiasis
hsa05144  Malaria
hsa05418  Fluid shear stress and atherosclerosis
Drug target
Camobucol: D06570
Elsibucol: D06582
Succinobucol: D06648
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    7412 (VCAM1)
   04668 TNF signaling pathway
    7412 (VCAM1)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    7412 (VCAM1)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    7412 (VCAM1)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7412 (VCAM1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7412 (VCAM1)
  09174 Infectious disease: parasitic
   05144 Malaria
    7412 (VCAM1)
   05143 African trypanosomiasis
    7412 (VCAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    7412 (VCAM1)
   04091 Lectins [BR:hsa04091]
    7412 (VCAM1)
CD molecules [BR:hsa04090]
 Proteins
  7412 (VCAM1)
Lectins [BR:hsa04091]
 I-type lectins (Siglecs)
  7412 (VCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: I-set Ig_3 C2-set ig Ig_2 V-set C2-set_2 ICAM_N Ig_4 Ig_5 Ig_6 Adhes-Ig_like
Motif
Other DBs
NCBI-GeneID: 7412
NCBI-ProteinID: NP_001069
OMIM: 192225
HGNC: 12663
Ensembl: ENSG00000162692
Vega: OTTHUMG00000010982
Pharos: P19320(Tchem)
UniProt: P19320
Structure
PDB: 

Position
1p21.2
AA seq 739 aa AA seqDB search
MPGKMVVILGASNILWIMFAASQAFKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWR
TQIDSPLNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLEKGIQVEIYSFPKDPE
IHLSGPLEAGKPITVKCSVADVYPFDRLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEV
TFTPVIEDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKNTVISVNPSTKLQEGG
SVTMTCSSEGLPAPEIFWSKKLDNGNLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKN
RKEVELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSFSWRTQIDSPLSGKVR
SEGTNSTLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSS
VTVSCKVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSLEMTFIPTIEDTGKA
LVCQAKLHIDDMEFEPKQRQSTQTLYVNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFP
APKILWSRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAGRSRKEVELIIQVTP
KDIKLTAFPSESVKEGDTVIISCTCGNVPETWIILKKKAETGDTVLKSIDGAYTIRKAQL
KDAGVYECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFASSLIIPAIGMIIYFA
RKANMKGSYSLVEAQKSKV
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagatggtcgtgatccttggagcctcaaatatactttggataatgtttgca
gcttctcaagcttttaaaatcgagaccaccccagaatctagatatcttgctcagattggt
gactccgtctcattgacttgcagcaccacaggctgtgagtccccatttttctcttggaga
acccagatagatagtccactgaatgggaaggtgacgaatgaggggaccacatctacgctg
acaatgaatcctgttagttttgggaacgaacactcttacctgtgcacagcaacttgtgaa
tctaggaaattggaaaaaggaatccaggtggagatctactcttttcctaaggatccagag
attcatttgagtggccctctggaggctgggaagccgatcacagtcaagtgttcagttgct
gatgtatacccatttgacaggctggagatagacttactgaaaggagatcatctcatgaag
agtcaggaatttctggaggatgcagacaggaagtccctggaaaccaagagtttggaagta
acctttactcctgtcattgaggatattggaaaagttcttgtttgccgagctaaattacac
attgatgaaatggattctgtgcccacagtaaggcaggctgtaaaagaattgcaagtctac
atatcacccaagaatacagttatttctgtgaatccatccacaaagctgcaagaaggtggc
tctgtgaccatgacctgttccagcgagggtctaccagctccagagattttctggagtaag
aaattagataatgggaatctacagcacctttctggaaatgcaactctcaccttaattgct
atgaggatggaagattctggaatttatgtgtgtgaaggagttaatttgattgggaaaaac
agaaaagaggtggaattaattgttcaagagaaaccatttactgttgagatctcccctgga
ccccggattgctgctcagattggagactcagtcatgttgacatgtagtgtcatgggctgt
gaatccccatctttctcctggagaacccagatagacagccctctgagcgggaaggtgagg
agtgaggggaccaattccacgctgaccctgagccctgtgagttttgagaacgaacactct
tatctgtgcacagtgacttgtggacataagaaactggaaaagggaatccaggtggagctc
tactcattccctagagatccagaaatcgagatgagtggtggcctcgtgaatgggagctct
gtcactgtaagctgcaaggttcctagcgtgtacccccttgaccggctggagattgaatta
cttaagggggagactattctggagaatatagagtttttggaggatacggatatgaaatct
ctagagaacaaaagtttggaaatgaccttcatccctaccattgaagatactggaaaagct
cttgtttgtcaggctaagttacatattgatgacatggaattcgaacccaaacaaaggcag
agtacgcaaacactttatgtcaatgttgcccccagagatacaaccgtcttggtcagccct
tcctccatcctggaggaaggcagttctgtgaatatgacatgcttgagccagggctttcct
gctccgaaaatcctgtggagcaggcagctccctaacggggagctacagcctctttctgag
aatgcaactctcaccttaatttctacaaaaatggaagattctggggtttatttatgtgaa
ggaattaaccaggctggaagaagcagaaaggaagtggaattaattatccaagttactcca
aaagacataaaacttacagcttttccttctgagagtgtcaaagaaggagacactgtcatc
atctcttgtacatgtggaaatgttccagaaacatggataatcctgaagaaaaaagcggag
acaggagacacagtactaaaatctatagatggcgcctataccatccgaaaggcccagttg
aaggatgcgggagtatatgaatgtgaatctaaaaacaaagttggctcacaattaagaagt
ttaacacttgatgttcaaggaagagaaaacaacaaagactatttttctcctgagcttctc
gtgctctattttgcatcctccttaataatacctgccattggaatgataatttactttgca
agaaaagccaacatgaaggggtcatatagtcttgtagaagcacagaagtcaaaagtgtag

DBGET integrated database retrieval system