KEGG   Homo sapiens (human): 7415Help
Entry
7415              CDS       T01001                                 

Gene name
VCP, CDC48, TERA, p97
Definition
(RefSeq) valosin containing protein
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05134  Legionellosis
Module
hsa_M00400  p97-Ufd1-Npl4 complex
hsa_M00403  HRD1/SEL1 ERAD complex
Disease
H00058  Amyotrophic lateral sclerosis (ALS)
H00078  Frontotemporal lobar degeneration
H00264  Charcot-Marie-Tooth disease
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7415 (VCP)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05134 Legionellosis
    7415 (VCP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7415 (VCP)
   04131 Membrane trafficking [BR:hsa04131]
    7415 (VCP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7415 (VCP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     7415 (VCP)
Membrane trafficking [BR:hsa04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    7415 (VCP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7415 (VCP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N AAA_16 CDC48_2 AAA_33 AAA_2 AAA_5 AAA_22 Vps4_C TIP49 AAA_18 RNA_helicase Mg_chelatase AAA_14 IstB_IS21 Parvo_NS1 AAA_28 ATPase ATPase_2 AAA_7 Bac_DnaA ABC_tran DUF815 AAA_24 TsaE Viral_helicase1 AAA_17 Sigma54_activat NACHT NB-ARC Zeta_toxin DUF2075 ResIII Rad17 UFD1 DUF3944
Motif
Other DBs
NCBI-GeneID: 7415
NCBI-ProteinID: NP_009057
OMIM: 601023
HGNC: 12666
Ensembl: ENSG00000165280
Vega: OTTHUMG00000019855
Pharos: P55072(Tchem)
UniProt: P55072 V9HW80
Structure
PDB: 

Position
9p13.3
AA seq 806 aa AA seqDB search
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt NT seq  +upstreamnt  +downstreamnt
atggcttctggagccgattcaaaaggtgatgacctatcaacagccattctcaaacagaag
aaccgtcccaatcggttaattgttgatgaagccatcaatgaggacaacagtgtggtgtcc
ttgtcccagcccaagatggatgaattgcagttgttccgaggtgacacagtgttgctgaaa
ggaaagaagagacgagaagctgtttgcatcgtcctttctgatgatacttgttctgatgag
aagattcggatgaatagagttgttcggaataaccttcgtgtacgcctaggggatgtcatc
agcatccagccatgccctgatgtgaagtacggcaaacgtatccatgtgctgcccattgat
gacacagtggaaggcattactggtaatctcttcgaggtataccttaagccgtacttcctg
gaagcgtatcgacccatccggaaaggagacatttttcttgtccgtggtgggatgcgtgct
gtggagttcaaagtggtggaaacagatcctagcccttattgcattgttgctccagacaca
gtgatccactgcgaaggggagcctatcaaacgagaggatgaggaagagtccttgaatgaa
gtagggtatgatgacattggtggctgcaggaagcagctagctcagataaaggagatggtg
gaactgcccctgagacatcctgccctctttaaggcaattggtgtgaagcctcctagagga
atcctgctttacggacctcctggaacaggaaagaccctgattgctcgagctgtagcaaat
gagactggagccttcttcttcttgatcaatggtcctgagatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaggctgagaagaatgctcctgccatc
atcttcattgatgagctagatgccatcgctcccaaaagagagaaaactcatggcgaggtg
gagcggcgcattgtatcacagttgttgaccctcatggatggcctaaagcagagggcacat
gtgattgttatggcagcaaccaacagacccaacagcattgacccagctctacggcgattt
ggtcgctttgacagggaggtagatattggaattcctgatgctacaggacgcttagagatt
cttcagatccataccaagaacatgaagctggcagatgatgtggacctggaacaggtagcc
aatgagactcacgggcatgtgggtgctgacttagcagccctgtgctcagaggctgctctg
caagccatccgcaagaagatggatctcattgacctagaggatgagaccattgatgccgag
gtcatgaactctctagcagttactatggatgacttccggtgggccttgagccagagtaac
ccatcagcactgcgggaaaccgtggtagaggtgccacaggtaacctgggaagacatcggg
ggcctagaggatgtcaaacgtgagctacaggagctggtccagtatcctgtggagcaccca
gacaaattcctgaagtttggcatgacaccttccaagggagttctgttctatggacctcct
ggctgtgggaaaactttgttggccaaagccattgctaatgaatgccaggccaacttcatc
tccatcaagggtcctgagctgctcaccatgtggtttggggagtctgaggccaatgtcaga
gaaatctttgacaaggcccgccaagctgccccctgtgtgctattctttgatgagctggat
tcgattgccaaggctcgtggaggtaacattggagatggtggtggggctgctgaccgagtc
atcaaccagatcctgacagaaatggatggcatgtccacaaaaaaaaatgtgttcatcatt
ggcgctaccaaccggcctgacatcattgatcctgccatcctcagacctggccgtcttgat
cagctcatctacatcccacttcctgatgagaagtcccgtgttgccatcctcaaggctaac
ctgcgcaagtccccagttgccaaggatgtggacttggagttcctggctaaaatgactaat
ggcttctctggagctgacctgacagagatttgccagcgtgcttgcaagctggccatccgt
gaatccatcgagagtgagattaggcgagaacgagagaggcagacaaacccatcagccatg
gaggtagaagaggatgatccagtgcctgagatccgtcgagatcactttgaagaagccatg
cgctttgcgcgccgttctgtcagtgacaatgacattcggaagtatgagatgtttgcccag
acccttcagcagagtcggggctttggcagcttcagattcccttcagggaaccagggtgga
gctggccccagtcagggcagtggaggcggcacaggtggcagtgtatacacagaagacaat
gatgatgacctgtatggctaa

DBGET integrated database retrieval system