KEGG   Homo sapiens (human): 7415
Entry
7415              CDS       T01001                                 
Symbol
VCP, CDC48, FTDALS6, TERA, p97
Name
(RefSeq) valosin containing protein
  KO
K13525  transitional endoplasmic reticulum ATPase
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa05014  Amyotrophic lateral sclerosis
hsa05022  Pathways of neurodegeneration - multiple diseases
hsa05134  Legionellosis
Network
nt06420  Ubiquitin-proteasome system
nt06464  Amyotrophic lateral sclerosis
nt06509  DNA replication
  Element
N01145  Mutation-inactivated VCP to 26S proteasome-mediated protein degradation
N01473  DNA replication termination
N01474  TRAIP-dependent replisome disassembly
Disease
H00264  Charcot-Marie-Tooth disease
H02031  Inclusion body myopathy with Paget disease of bone and frontotemporal dementia
H02342  Frontotemporal dementia and amyotrophic lateral sclerosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7415 (VCP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    7415 (VCP)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    7415 (VCP)
   05022 Pathways of neurodegeneration - multiple diseases
    7415 (VCP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7415 (VCP)
   03009 Ribosome biogenesis [BR:hsa03009]
    7415 (VCP)
   04131 Membrane trafficking [BR:hsa04131]
    7415 (VCP)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7415 (VCP)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     7415 (VCP)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic type
  Pre-60S particles
   Ribosome quality control proteins
    7415 (VCP)
Membrane trafficking [BR:hsa04131]
 SNARE
  SNARE associated proteins
   Others
    7415 (VCP)
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    7415 (VCP)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   7415 (VCP)
SSDB
Motif
Pfam: AAA AAA_lid_3 CDC48_N RuvB_N CDC48_2 AAA_16 AAA_33 AAA_2 AAA_5 AAA_22 TIP49 Vps4_C AAA_18 RNA_helicase AAA_14 Mg_chelatase IstB_IS21 AAA_28 Parvo_NS1 AAA_7 ATPase ATPase_2 Bac_DnaA ABC_tran DUF815 AAA_17 AAA_24 TsaE Viral_helicase1 Sigma54_activat NACHT Zeta_toxin NB-ARC DUF2075 ResIII bpMoxR UFD1 DUF3944
Other DBs
NCBI-GeneID: 7415
NCBI-ProteinID: NP_009057
OMIM: 601023
HGNC: 12666
Ensembl: ENSG00000165280
Pharos: P55072(Tchem)
UniProt: P55072 V9HW80
Structure
Position
9:complement(35056064..35072625)
AA seq 806 aa
MASGADSKGDDLSTAILKQKNRPNRLIVDEAINEDNSVVSLSQPKMDELQLFRGDTVLLK
GKKRREAVCIVLSDDTCSDEKIRMNRVVRNNLRVRLGDVISIQPCPDVKYGKRIHVLPID
DTVEGITGNLFEVYLKPYFLEAYRPIRKGDIFLVRGGMRAVEFKVVETDPSPYCIVAPDT
VIHCEGEPIKREDEEESLNEVGYDDIGGCRKQLAQIKEMVELPLRHPALFKAIGVKPPRG
ILLYGPPGTGKTLIARAVANETGAFFFLINGPEIMSKLAGESESNLRKAFEEAEKNAPAI
IFIDELDAIAPKREKTHGEVERRIVSQLLTLMDGLKQRAHVIVMAATNRPNSIDPALRRF
GRFDREVDIGIPDATGRLEILQIHTKNMKLADDVDLEQVANETHGHVGADLAALCSEAAL
QAIRKKMDLIDLEDETIDAEVMNSLAVTMDDFRWALSQSNPSALRETVVEVPQVTWEDIG
GLEDVKRELQELVQYPVEHPDKFLKFGMTPSKGVLFYGPPGCGKTLLAKAIANECQANFI
SIKGPELLTMWFGESEANVREIFDKARQAAPCVLFFDELDSIAKARGGNIGDGGGAADRV
INQILTEMDGMSTKKNVFIIGATNRPDIIDPAILRPGRLDQLIYIPLPDEKSRVAILKAN
LRKSPVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAIRESIESEIRRERERQTNPSAM
EVEEDDPVPEIRRDHFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFGSFRFPSGNQGG
AGPSQGSGGGTGGSVYTEDNDDDLYG
NT seq 2421 nt   +upstreamnt  +downstreamnt
atggcttctggagccgattcaaaaggtgatgacctatcaacagccattctcaaacagaag
aaccgtcccaatcggttaattgttgatgaagccatcaatgaggacaacagtgtggtgtcc
ttgtcccagcccaagatggatgaattgcagttgttccgaggtgacacagtgttgctgaaa
ggaaagaagagacgagaagctgtttgcatcgtcctttctgatgatacttgttctgatgag
aagattcggatgaatagagttgttcggaataaccttcgtgtacgcctaggggatgtcatc
agcatccagccatgccctgatgtgaagtacggcaaacgtatccatgtgctgcccattgat
gacacagtggaaggcattactggtaatctcttcgaggtataccttaagccgtacttcctg
gaagcgtatcgacccatccggaaaggagacatttttcttgtccgtggtgggatgcgtgct
gtggagttcaaagtggtggaaacagatcctagcccttattgcattgttgctccagacaca
gtgatccactgcgaaggggagcctatcaaacgagaggatgaggaagagtccttgaatgaa
gtagggtatgatgacattggtggctgcaggaagcagctagctcagataaaggagatggtg
gaactgcccctgagacatcctgccctctttaaggcaattggtgtgaagcctcctagagga
atcctgctttacggacctcctggaacaggaaagaccctgattgctcgagctgtagcaaat
gagactggagccttcttcttcttgatcaatggtcctgagatcatgagcaaattggctggt
gagtctgagagcaaccttcgtaaagcctttgaggaggctgagaagaatgctcctgccatc
atcttcattgatgagctagatgccatcgctcccaaaagagagaaaactcatggcgaggtg
gagcggcgcattgtatcacagttgttgaccctcatggatggcctaaagcagagggcacat
gtgattgttatggcagcaaccaacagacccaacagcattgacccagctctacggcgattt
ggtcgctttgacagggaggtagatattggaattcctgatgctacaggacgcttagagatt
cttcagatccataccaagaacatgaagctggcagatgatgtggacctggaacaggtagcc
aatgagactcacgggcatgtgggtgctgacttagcagccctgtgctcagaggctgctctg
caagccatccgcaagaagatggatctcattgacctagaggatgagaccattgatgccgag
gtcatgaactctctagcagttactatggatgacttccggtgggccttgagccagagtaac
ccatcagcactgcgggaaaccgtggtagaggtgccacaggtaacctgggaagacatcggg
ggcctagaggatgtcaaacgtgagctacaggagctggtccagtatcctgtggagcaccca
gacaaattcctgaagtttggcatgacaccttccaagggagttctgttctatggacctcct
ggctgtgggaaaactttgttggccaaagccattgctaatgaatgccaggccaacttcatc
tccatcaagggtcctgagctgctcaccatgtggtttggggagtctgaggccaatgtcaga
gaaatctttgacaaggcccgccaagctgccccctgtgtgctattctttgatgagctggat
tcgattgccaaggctcgtggaggtaacattggagatggtggtggggctgctgaccgagtc
atcaaccagatcctgacagaaatggatggcatgtccacaaaaaaaaatgtgttcatcatt
ggcgctaccaaccggcctgacatcattgatcctgccatcctcagacctggccgtcttgat
cagctcatctacatcccacttcctgatgagaagtcccgtgttgccatcctcaaggctaac
ctgcgcaagtccccagttgccaaggatgtggacttggagttcctggctaaaatgactaat
ggcttctctggagctgacctgacagagatttgccagcgtgcttgcaagctggccatccgt
gaatccatcgagagtgagattaggcgagaacgagagaggcagacaaacccatcagccatg
gaggtagaagaggatgatccagtgcctgagatccgtcgagatcactttgaagaagccatg
cgctttgcgcgccgttctgtcagtgacaatgacattcggaagtatgagatgtttgcccag
acccttcagcagagtcggggctttggcagcttcagattcccttcagggaaccagggtgga
gctggccccagtcagggcagtggaggcggcacaggtggcagtgtatacacagaagacaat
gatgatgacctgtatggctaa

DBGET integrated database retrieval system