KEGG   Homo sapiens (human): 7416Help
Entry
7416              CDS       T01001                                 

Gene name
VDAC1, PORIN, VDAC-1
Definition
(RefSeq) voltage dependent anion channel 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
Network
nt06131  Apoptosis (virus)
nt06170  Influenza A virus (IAV)
  Element
N00745  IAV PB1-F2 to intrinsic apoptotic pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7416 (VDAC1)
   04022 cGMP-PKG signaling pathway
    7416 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    7416 (VDAC1)
   04218 Cellular senescence
    7416 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7416 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    7416 (VDAC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7416 (VDAC1)
   05016 Huntington disease
    7416 (VDAC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7416 (VDAC1)
   05164 Influenza A
    7416 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7416 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7416 (VDAC1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7416 (VDAC1)
Ion channels [BR:hsa04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   7416 (VDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 7416
NCBI-ProteinID: NP_003365
OMIM: 604492
HGNC: 12669
Ensembl: ENSG00000213585
Vega: OTTHUMG00000129118
Pharos: P21796(Tbio)
UniProt: P21796 A0A1L1UHR1 B3KTS5
Structure
PDB: 

Position
5q31.1
AA seq 283 aa AA seqDB search
MAVPPTYADLGKSARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDMDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgccacccacgtatgccgatcttggcaaatctgccagggatgtcttcaccaag
ggctatggatttggcttaataaagcttgatttgaaaacaaaatctgagaatggattggaa
tttacaagctcaggctcagccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacagatggactgagtacggcctgacgtttacagagaaatggaataccgacaataca
ctaggcaccgagattactgtggaagatcagcttgcacgtggactgaagctgaccttcgat
tcatccttctcacctaacactgggaaaaaaaatgctaaaatcaagacagggtacaagcgg
gagcacattaacctgggctgcgacatggatttcgacattgctgggccttccatccggggt
gctctggtgctaggttacgagggctggctggccggctaccagatgaattttgagactgca
aaatcccgagtgacccagagcaactttgcagttggctacaagactgatgaattccagctt
cacactaatgtgaatgacgggacagagtttggcggctccatttaccagaaagtgaacaag
aagttggagaccgctgtcaatcttgcctggacagcaggaaacagtaacacgcgcttcgga
atagcagccaagtatcagattgaccctgacgcctgcttctcggctaaagtgaacaactcc
agcctgataggtttaggatacactcagactctaaagccaggtattaaactgacactgtca
gctcttctggatggcaagaacgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaagcataa

KEGG   Homo sapiens (human): 7417Help
Entry
7417              CDS       T01001                                 

Gene name
VDAC2, POR
Definition
(RefSeq) voltage dependent anion channel 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7417 (VDAC2)
   04022 cGMP-PKG signaling pathway
    7417 (VDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    7417 (VDAC2)
   04217 Necroptosis
    7417 (VDAC2)
   04218 Cellular senescence
    7417 (VDAC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7417 (VDAC2)
  09154 Digestive system
   04979 Cholesterol metabolism
    7417 (VDAC2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7417 (VDAC2)
   05016 Huntington disease
    7417 (VDAC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7417 (VDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7417 (VDAC2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7417 (VDAC2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7417 (VDAC2)
Ion channels [BR:hsa04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   7417 (VDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 7417
NCBI-ProteinID: NP_001171752
OMIM: 193245
HGNC: 12672
Ensembl: ENSG00000165637
Vega: OTTHUMG00000018517
Pharos: P45880(Tchem)
UniProt: P45880 A0A024QZT0
Position
10q22.2
AA seq 294 aa AA seqDB search
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK
KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF
AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP
TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccacggacagacttgcgcgcgtccaatgtgtattcctccatcatatgctgac
cttggcaaagctgccagagatattttcaacaaaggatttggttttgggttggtgaaactg
gatgtgaaaacaaagtcttgcagtggcgtggaattttcaacgtccggttcatctaataca
gacactggtaaagttactgggaccttggagaccaaatacaagtggtgtgagtatggtctg
actttcacagaaaagtggaacactgataacactctgggaacagaaatcgcaattgaagac
cagatttgtcaaggtttgaaactgacatttgatactaccttctcaccaaacacaggaaag
aaaagtggtaaaatcaagtcttcttacaagagggagtgtataaaccttggttgtgatgtt
gactttgattttgctggacctgcaatccatggttcagctgtctttggttatgagggctgg
cttgctggctaccagatgacctttgacagtgccaaatcaaagctgacaaggaataacttt
gcagtgggctacaggactggggacttccagctacacactaatgtcaatgatgggacagaa
tttggaggatcaatttatcagaaagtttgtgaagatcttgacacttcagtaaaccttgct
tggacatcaggtaccaactgcactcgttttggcattgcagctaaatatcagttggatccc
actgcttccatttctgcaaaagtcaacaactctagcttaattggagtaggctatactcag
actctgaggcctggtgtgaagcttacactctctgctctggtagatgggaagagcattaat
gctggaggccacaaggttgggctcgccctggagttggaggcttaa

KEGG   Homo sapiens (human): 7419Help
Entry
7419              CDS       T01001                                 

Gene name
VDAC3, HD-VDAC3, VDAC-3
Definition
(RefSeq) voltage dependent anion channel 3
  KO
K15041  voltage-dependent anion channel protein 3
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05161  Hepatitis B
hsa05166  Human T-cell leukemia virus 1 infection
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06162  Hepatitis B virus (HBV)
  Element
N00539  HBV HBx to Ca2+-PYK2-RAS-ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7419 (VDAC3)
   04022 cGMP-PKG signaling pathway
    7419 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    7419 (VDAC3)
   04217 Necroptosis
    7419 (VDAC3)
   04218 Cellular senescence
    7419 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7419 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    7419 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7419 (VDAC3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    7419 (VDAC3)
   05016 Huntington disease
    7419 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    7419 (VDAC3)
   05161 Hepatitis B
    7419 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7419 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7419 (VDAC3)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7419 (VDAC3)
Ion channels [BR:hsa04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   7419 (VDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 7419
NCBI-ProteinID: NP_005653
OMIM: 610029
HGNC: 12674
Ensembl: ENSG00000078668
Vega: OTTHUMG00000164168
Pharos: Q9Y277(Tbio)
UniProt: Q9Y277
Position
8p11.21
AA seq 283 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLKTKSCSGVEFSTSGHAYTDTGKASGNLET
KYKVCNYGLTFTQKWNTDNTLGTEISWENKLAEGLKLTLDTIFVPNTGKKSGKLKASYKR
DCFSVGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQL
HTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYMLDCRTSLSAKVNNA
SLIGLGYTQTLRPGVKLTLSALIDGKNFSAGGHKVGLGFELEA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacgtactgtgacctaggaaaggctgctaaggatgtcttcaacaaa
ggatatggctttggcatggtcaagatagacctgaaaaccaagtcttgtagtggagtggaa
ttttctacttctggtcatgcttacactgatacagggaaagcatcaggcaacctagaaacc
aaatataaggtctgtaactatggacttaccttcacccagaaatggaacacagacaatact
ctagggacagaaatctcttgggagaataagttggctgaagggttgaaactgactcttgat
accatatttgtaccgaacacaggaaagaagagtgggaaattgaaggcctcctataaacgg
gattgttttagtgttggcagtaatgttgatatagatttttctggaccaaccatctatggc
tgggctgtgttggccttcgaagggtggcttgctggctatcagatgagttttgacacagcc
aaatccaaactgtcacagaataatttcgccctgggttacaaggctgcggacttccagctg
cacacacatgtgaacgatggcactgaatttggaggttctatctaccagaaggtgaatgag
aagattgaaacatccataaaccttgcttggacagctgggagtaacaacacccgttttggc
attgctgctaagtacatgctggattgtagaacttctctctctgctaaagtaaataatgcc
agcctgattggactgggttatactcagacccttcgaccaggagtcaaattgactttatca
gctttaatcgatgggaagaacttcagtgcaggaggtcacaaggttggcttgggatttgaa
ctggaagcttaa

DBGET integrated database retrieval system