KEGG   Homo sapiens (human): 7417Help
Entry
7417              CDS       T01001                                 

Gene name
VDAC2, POR
Definition
(RefSeq) voltage dependent anion channel 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04020  Calcium signaling pathway
hsa04022  cGMP-PKG signaling pathway
hsa04216  Ferroptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04621  NOD-like receptor signaling pathway
hsa04979  Cholesterol metabolism
hsa05012  Parkinson disease
hsa05016  Huntington disease
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    7417 (VDAC2)
   04022 cGMP-PKG signaling pathway
    7417 (VDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    7417 (VDAC2)
   04217 Necroptosis
    7417 (VDAC2)
   04218 Cellular senescence
    7417 (VDAC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    7417 (VDAC2)
  09154 Digestive system
   04979 Cholesterol metabolism
    7417 (VDAC2)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05012 Parkinson disease
    7417 (VDAC2)
   05016 Huntington disease
    7417 (VDAC2)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7417 (VDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7417 (VDAC2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:hsa04040]
    7417 (VDAC2)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    7417 (VDAC2)
Ion channels [BR:hsa04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   7417 (VDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 7417
NCBI-ProteinID: NP_001171752
OMIM: 193245
HGNC: 12672
Ensembl: ENSG00000165637
Vega: OTTHUMG00000018517
Pharos: P45880(Tchem)
UniProt: P45880 A0A024QZT0
Position
10q22.2
AA seq 294 aa AA seqDB search
MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK
KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF
AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP
TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKVGLALELEA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgacccacggacagacttgcgcgcgtccaatgtgtattcctccatcatatgctgac
cttggcaaagctgccagagatattttcaacaaaggatttggttttgggttggtgaaactg
gatgtgaaaacaaagtcttgcagtggcgtggaattttcaacgtccggttcatctaataca
gacactggtaaagttactgggaccttggagaccaaatacaagtggtgtgagtatggtctg
actttcacagaaaagtggaacactgataacactctgggaacagaaatcgcaattgaagac
cagatttgtcaaggtttgaaactgacatttgatactaccttctcaccaaacacaggaaag
aaaagtggtaaaatcaagtcttcttacaagagggagtgtataaaccttggttgtgatgtt
gactttgattttgctggacctgcaatccatggttcagctgtctttggttatgagggctgg
cttgctggctaccagatgacctttgacagtgccaaatcaaagctgacaaggaataacttt
gcagtgggctacaggactggggacttccagctacacactaatgtcaatgatgggacagaa
tttggaggatcaatttatcagaaagtttgtgaagatcttgacacttcagtaaaccttgct
tggacatcaggtaccaactgcactcgttttggcattgcagctaaatatcagttggatccc
actgcttccatttctgcaaaagtcaacaactctagcttaattggagtaggctatactcag
actctgaggcctggtgtgaagcttacactctctgctctggtagatgggaagagcattaat
gctggaggccacaaggttgggctcgccctggagttggaggcttaa

DBGET integrated database retrieval system