KEGG   Homo sapiens (human): 7421Help
Entry
7421              CDS       T01001                                 

Gene name
VDR, NR1I1, PPP1R163
Definition
(RefSeq) vitamin D receptor
  KO
K08539  vitamin D3 receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04928  Parathyroid hormone synthesis, secretion and action
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa04978  Mineral absorption
hsa05152  Tuberculosis
Disease
H00342  Tuberculosis
H00784  Localized autosomal recessive hypotrichosis
H01143  Vitamin D-dependent rickets
H01593  Osteoporosis
Drug target
Alfacalcidol: D01518
Becocalcidiol: D08868
Calcifediol (DG00124): D00122
Calcipotriol (DG00394): D01125 D10198
Calcitriol: D00129
Colecalciferol: D00188
Dihydrotachysterol: D00299
Doxercalciferol: D01009
Ecalcidene: D03930
Eldecalcitol: D07578
Ergocalciferol: D00187
Falecalcitriol: D01662
Maxacalcitol: D01098
Paricalcitol: D00930
Pefcalcitol: D10565
Secalciferol: D00628
Tacalcitol (DG00395): D01472 D08554
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    7421 (VDR)
  09154 Digestive system
   04978 Mineral absorption
    7421 (VDR)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    7421 (VDR)
 09160 Human Diseases
  09171 Infectious diseases: Bacterial
   05152 Tuberculosis
    7421 (VDR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7421 (VDR)
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7421 (VDR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:hsa03310]
    7421 (VDR)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7421 (VDR)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys4 thyroid hormone-like
    7421 (VDR)
Nuclear receptors [BR:hsa03310]
 1. Thyroid hormone like
  1I. Vitamin D3 like receptor
   7421 (VDR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C4 Hormone_recep zf-RRPl_C4
Motif
Other DBs
NCBI-GeneID: 7421
NCBI-ProteinID: NP_000367
OMIM: 601769
HGNC: 12679
Ensembl: ENSG00000111424
Vega: OTTHUMG00000169890
Pharos: P11473(Tclin)
UniProt: P11473 F1D8P8
Structure
PDB: 

Position
12q13.11
AA seq 427 aa AA seqDB search
MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTC
PFNGDCRITKDNRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSL
RPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVRVNDGGGSHPSRPNSRHTPSFSG
DSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYSIQK
VIGFAKMIPGFRDLTSEDQIVLLKSSAIEVIMLRSNESFTMDDMSWTCGNQDYKYRVSDV
TKAGHSLELIEPLIKFQVGLKKLNLHEEEHVLLMAICIVSPDRPGVQDAALIEAIQDRLS
NTLQTYIRCRHPPPGSHLLYAKMIQKLADLRSLNEEHSKQYRCLSFQPECSMKLTPLVLE
VFGNEIS
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaatggcggccagcacttccctgcctgaccctggagactttgaccggaacgtg
ccccggatctgtggggtgtgtggagaccgagccactggctttcacttcaatgctatgacc
tgtgaaggctgcaaaggcttcttcaggcgaagcatgaagcggaaggcactattcacctgc
cccttcaacggggactgccgcatcaccaaggacaaccgacgccactgccaggcctgccgg
ctcaaacgctgtgtggacatcggcatgatgaaggagttcattctgacagatgaggaagtg
cagaggaagcgggagatgatcctgaagcggaaggaggaggaggccttgaaggacagtctg
cggcccaagctgtctgaggagcagcagcgcatcattgccatactgctggacgcccaccat
aagacctacgaccccacctactccgacttctgccagttccggcctccagttcgtgtgaat
gatggtggagggagccatccttccaggcccaactccagacacactcccagcttctctggg
gactcctcctcctcctgctcagatcactgtatcacctcttcagacatgatggactcgtcc
agcttctccaatctggatctgagtgaagaagattcagatgacccttctgtgaccctagag
ctgtcccagctctccatgctgccccacctggctgacctggtcagttacagcatccaaaag
gtcattggctttgctaagatgataccaggattcagagacctcacctctgaggaccagatc
gtactgctgaagtcaagtgccattgaggtcatcatgttgcgctccaatgagtccttcacc
atggacgacatgtcctggacctgtggcaaccaagactacaagtaccgcgtcagtgacgtg
accaaagccggacacagcctggagctgattgagcccctcatcaagttccaggtgggactg
aagaagctgaacttgcatgaggaggagcatgtcctgctcatggccatctgcatcgtctcc
ccagatcgtcctggggtgcaggacgccgcgctgattgaggccatccaggaccgcctgtcc
aacacactgcagacgtacatccgctgccgccacccgcccccgggcagccacctgctctat
gccaagatgatccagaagctagccgacctgcgcagcctcaatgaggagcactccaagcag
taccgctgcctctccttccagcctgagtgcagcatgaagctaacgccccttgtgctcgaa
gtgtttggcaatgagatctcctga

DBGET integrated database retrieval system