KEGG   Homo sapiens (human): 7422
Entry
7422              CDS       T01001                                 

Gene name
VEGFA, MVCD1, VEGF, VPF
Definition
(RefSeq) vascular endothelial growth factor A
  KO
K05448  vascular endothelial growth factor A
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04370  VEGF signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05163  Human cytomegalovirus infection
hsa05165  Human papillomavirus infection
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05212  Pancreatic cancer
hsa05219  Bladder cancer
hsa05323  Rheumatoid arthritis
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06214  PI3K signaling
nt06219  JAK-STAT signaling
nt06224  CXCR signaling
nt06225  HIF-1 signaling
nt06262  Pancreatic cancer
nt06264  Renal cell carcinoma
  Element
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00095  ERBB2-overexpression to EGF-Jak-STAT signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
N00179  KSHV K1 to PI3K-NFKB signaling pathway
Disease
H01456  Diabetic nephropathy
H01457  Diabetic retinopathy
H01459  Diabetic neuropathy
H01529  Avascular necrosis of femoral head
H01709  Glucocorticoid-induced osteonecrosis
Drug target
Abicipar pegol: D11517
Aflibercept: D09574<JP/US>
Aflibercept beta: D10819<JP>
Bevacizumab: D06409<JP/US>
Bevasiranib sodium: D08874
Brolucizumab: D11083<JP>
Dilpacimab: D11642
Emvododstat: D11890
Faricimab: D11516
Navicixizumab: D11126
Pegaptanib: D05386
Ranibizumab: D05697<JP/US>
Vanucizumab: D11244
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7422 (VEGFA)
   04014 Ras signaling pathway
    7422 (VEGFA)
   04015 Rap1 signaling pathway
    7422 (VEGFA)
   04370 VEGF signaling pathway
    7422 (VEGFA)
   04066 HIF-1 signaling pathway
    7422 (VEGFA)
   04151 PI3K-Akt signaling pathway
    7422 (VEGFA)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7422 (VEGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7422 (VEGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7422 (VEGFA)
   05206 MicroRNAs in cancer
    7422 (VEGFA)
   05205 Proteoglycans in cancer
    7422 (VEGFA)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    7422 (VEGFA)
   05211 Renal cell carcinoma
    7422 (VEGFA)
   05219 Bladder cancer
    7422 (VEGFA)
  09163 Immune disease
   05323 Rheumatoid arthritis
    7422 (VEGFA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    7422 (VEGFA)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7422 (VEGFA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    7422 (VEGFA)
   05167 Kaposi sarcoma-associated herpesvirus infection
    7422 (VEGFA)
   05165 Human papillomavirus infection
    7422 (VEGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    7422 (VEGFA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7422 (VEGFA)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7422 (VEGFA)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   7422 (VEGFA)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   7422 (VEGFA)
SSDB
Motif
Pfam: VEGF_C PDGF
Other DBs
NCBI-GeneID: 7422
NCBI-ProteinID: NP_001165094
OMIM: 192240
HGNC: 12680
Ensembl: ENSG00000112715
Vega: OTTHUMG00000014745
Pharos: P15692(Tclin)
UniProt: P15692 A0A024RD33
Structure
PDB: 

Position
6p21.1
AA seq 232 aa
MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVD
IFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEM
SFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPG
PHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaactttctgctgtcttgggtgcattggagccttgccttgctgctctacctccaccat
gccaagtggtcccaggctgcacccatggcagaaggaggagggcagaatcatcacgaagtg
gtgaagttcatggatgtctatcagcgcagctactgccatccaatcgagaccctggtggac
atcttccaggagtaccctgatgagatcgagtacatcttcaagccatcctgtgtgcccctg
atgcgatgcgggggctgctgcaatgacgagggcctggagtgtgtgcccactgaggagtcc
aacatcaccatgcagattatgcggatcaaacctcaccaaggccagcacataggagagatg
agcttcctacagcacaacaaatgtgaatgcagaccaaagaaagatagagcaagacaagaa
aaaaaatcagttcgaggaaagggaaaggggcaaaaacgaaagcgcaagaaatcccggtat
aagtcctggagcgtgtacgttggtgcccgctgctgtctaatgccctggagcctccctggc
ccccatccctgtgggccttgctcagagcggagaaagcatttgtttgtacaagatccgcag
acgtgtaaatgttcctgcaaaaacacagactcgcgttgcaaggcgaggcagcttgagtta
aacgaacgtacttgcagatgtgacaagccgaggcggtga

KEGG   Homo sapiens (human): 5155
Entry
5155              CDS       T01001                                 

Gene name
PDGFB, IBGC5, PDGF-2, PDGF2, SIS, SSV, c-sis
Definition
(RefSeq) platelet derived growth factor subunit B
  KO
K17386  platelet-derived growth factor subunit B
Organism
hsa  Homo sapiens (human)
Pathway
hsa01521  EGFR tyrosine kinase inhibitor resistance
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04072  Phospholipase D signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04540  Gap junction
hsa04630  JAK-STAT signaling pathway
hsa04810  Regulation of actin cytoskeleton
hsa05167  Kaposi sarcoma-associated herpesvirus infection
hsa05200  Pathways in cancer
hsa05206  MicroRNAs in cancer
hsa05211  Renal cell carcinoma
hsa05214  Glioma
hsa05215  Prostate cancer
hsa05218  Melanoma
hsa05231  Choline metabolism in cancer
hsa05418  Fluid shear stress and atherosclerosis
Network
nt06110  MAPK signaling (viruses)
nt06114  PI3K signaling (viruses)
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06166  Human papillomavirus (HPV)
nt06167  Human cytomegalovirus (HCMV)
nt06210  ERK signaling
nt06214  PI3K signaling
nt06220  Calcium signaling
nt06224  CXCR signaling
nt06225  HIF-1 signaling
nt06264  Renal cell carcinoma
nt06273  Glioma
  Element
N00015  PDGF-PDGFR-RAS-ERK signaling pathway
N00016  PDGF-overexpression to RAS-ERK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00039  PDGF-PDGFR-PI3K signaling pathway
N00079  HIF-1 signaling pathway
N00080  Loss of VHL to HIF-1 signaling pathway
N00081  Mutation-inactivated VHL to HIF-1 signaling pathway
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Disease
H00015  Malignant pleural mesothelioma
H00042  Glioma
H01574  Familial idiopathic basal ganglia calcification
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    5155 (PDGFB)
   04014 Ras signaling pathway
    5155 (PDGFB)
   04015 Rap1 signaling pathway
    5155 (PDGFB)
   04630 JAK-STAT signaling pathway
    5155 (PDGFB)
   04020 Calcium signaling pathway
    5155 (PDGFB)
   04072 Phospholipase D signaling pathway
    5155 (PDGFB)
   04151 PI3K-Akt signaling pathway
    5155 (PDGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    5155 (PDGFB)
   04540 Gap junction
    5155 (PDGFB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    5155 (PDGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    5155 (PDGFB)
   05206 MicroRNAs in cancer
    5155 (PDGFB)
   05231 Choline metabolism in cancer
    5155 (PDGFB)
  09162 Cancer: specific types
   05214 Glioma
    5155 (PDGFB)
   05218 Melanoma
    5155 (PDGFB)
   05211 Renal cell carcinoma
    5155 (PDGFB)
   05215 Prostate cancer
    5155 (PDGFB)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    5155 (PDGFB)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    5155 (PDGFB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    5155 (PDGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    5155 (PDGFB)
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    5155 (PDGFB)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   5155 (PDGFB)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   5155 (PDGFB)
SSDB
Motif
Pfam: PDGF PDGF_N
Other DBs
NCBI-GeneID: 5155
NCBI-ProteinID: NP_002599
OMIM: 190040
HGNC: 8800
Ensembl: ENSG00000100311
Vega: OTTHUMG00000151029
Pharos: P01127(Tchem)
UniProt: P01127 A0A384NYY3
Structure
PDB: 
4HQU 4QCI 4HQX 3MJG 1PDG

Position
22q13.1
AA seq 241 aa
MNRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGDPGEEDGAEL
DLNMTRSHSGGELESLARGRRSLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLV
WPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKC
ETVAAARPVTRSPGGSQEQRAKTPQTRVTIRTVRVRRPPKGKHRKFKHTHDKTALKETLG
A
NT seq 726 nt   +upstreamnt  +downstreamnt
atgaatcgctgctgggcgctcttcctgtctctctgctgctacctgcgtctggtcagcgcc
gagggggaccccattcccgaggagctttatgagatgctgagtgaccactcgatccgctcc
tttgatgatctccaacgcctgctgcacggagaccccggagaggaagatggggccgagttg
gacctgaacatgacccgctcccactctggaggcgagctggagagcttggctcgtggaaga
aggagcctgggttccctgaccattgctgagccggccatgatcgccgagtgcaagacgcgc
accgaggtgttcgagatctcccggcgcctcatagaccgcaccaacgccaacttcctggtg
tggccgccctgtgtggaggtgcagcgctgctccggctgctgcaacaaccgcaacgtgcag
tgccgccccacccaggtgcagctgcgacctgtccaggtgagaaagatcgagattgtgcgg
aagaagccaatctttaagaaggccacggtgacgctggaagaccacctggcatgcaagtgt
gagacagtggcagctgcacggcctgtgacccgaagcccggggggttcccaggagcagcga
gccaaaacgccccaaactcgggtgaccattcggacggtgcgagtccgccggccccccaag
ggcaagcaccggaaattcaagcacacgcatgacaagacggcactgaaggagacccttgga
gcctag

KEGG   Homo sapiens (human): 285
Entry
285               CDS       T01001                                 

Gene name
ANGPT2, AGPT2, ANG2
Definition
(RefSeq) angiopoietin 2
  KO
K05466  angiopoietin 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa05167  Kaposi sarcoma-associated herpesvirus infection
Network
nt06124  Chemokine signaling (viruses)
nt06150  Cytokine-cytokine receptor interaction (viruses)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06224  CXCR signaling
  Element
N00157  KSHV vGPCR to GNB/G-ERK signaling pathway
Drug target
Faricimab: D11516
Nesvacumab: D10395
Trebananib: D10177
Vanucizumab: D11244
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    285 (ANGPT2)
   04014 Ras signaling pathway
    285 (ANGPT2)
   04015 Rap1 signaling pathway
    285 (ANGPT2)
   04066 HIF-1 signaling pathway
    285 (ANGPT2)
   04151 PI3K-Akt signaling pathway
    285 (ANGPT2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    285 (ANGPT2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    285 (ANGPT2)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   285 (ANGPT2)
SSDB
Motif
Pfam: Fibrinogen_C DUF5713
Other DBs
NCBI-GeneID: 285
NCBI-ProteinID: NP_001138
OMIM: 601922
HGNC: 485
Ensembl: ENSG00000091879
Vega: OTTHUMG00000090365
Pharos: O15123(Tbio)
UniProt: O15123
Structure
PDB: 
4JZC 1Z3U 4ZFG 1Z3S 2GY7

Position
8p23.1
AA seq 496 aa
MWQIVFFTLSCDLVLAAAYNNFRKSMDSIGKKQYQVQHGSCSYTFLLPEMDNCRSSSSPY
VSNAVQRDAPLEYDDSVQRLQVLENIMENNTQWLMKLENYIQDNMKKEMVEIQQNAVQNQ
TAVMIEIGTNLLNQTAEQTRKLTDVEAQVLNQTTRLELQLLEHSLSTNKLEKQILDQTSE
INKLQDKNSFLEKKVLAMEDKHIIQLQSIKEEKDQLQVLVSKQNSIIEELEKKIVTATVN
NSVLQKQQHDLMETVNNLLTMMSTSNSAKDPTVAKEEQISFRDCAEVFKSGHTTNGIYTL
TFPNSTEEIKAYCDMEAGGGGWTIIQRREDGSVDFQRTWKEYKVGFGNPSGEYWLGNEFV
SQLTNQQRYVLKIHLKDWEGNEAYSLYEHFYLSSEELNYRIHLKGLTGTAGKISSISQPG
NDFSTKDGDNDKCICKCSQMLTGGWWFDACGPSNLNGMYYPQRQNTNKFNGIKWYYWKGS
GYSLKATTMMIRPADF
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgtggcagattgttttctttactctgagctgtgatcttgtcttggccgcagcctataac
aactttcggaagagcatggacagcataggaaagaagcaatatcaggtccagcatgggtcc
tgcagctacactttcctcctgccagagatggacaactgccgctcttcctccagcccctac
gtgtccaatgctgtgcagagggacgcgccgctcgaatacgatgactcggtgcagaggctg
caagtgctggagaacatcatggaaaacaacactcagtggctaatgaagcttgagaattat
atccaggacaacatgaagaaagaaatggtagagatacagcagaatgcagtacagaaccag
acggctgtgatgatagaaatagggacaaacctgttgaaccaaacagcggagcaaacgcgg
aagttaactgatgtggaagcccaagtattaaatcagaccacgagacttgaacttcagctc
ttggaacactccctctcgacaaacaaattggaaaaacagattttggaccagaccagtgaa
ataaacaaattgcaagataagaacagtttcctagaaaagaaggtgctagctatggaagac
aagcacatcatccaactacagtcaataaaagaagagaaagatcagctacaggtgttagta
tccaagcaaaattccatcattgaagaactagaaaaaaaaatagtgactgccacggtgaat
aattcagttcttcagaagcagcaacatgatctcatggagacagttaataacttactgact
atgatgtccacatcaaactcagctaaggaccccactgttgctaaagaagaacaaatcagc
ttcagagactgtgctgaagtattcaaatcaggacacaccacgaatggcatctacacgtta
acattccctaattctacagaagagatcaaggcctactgtgacatggaagctggaggaggc
gggtggacaattattcagcgacgtgaggatggcagcgttgattttcagaggacttggaaa
gaatataaagtgggatttggtaacccttcaggagaatattggctgggaaatgagtttgtt
tcgcaactgactaatcagcaacgctatgtgcttaaaatacaccttaaagactgggaaggg
aatgaggcttactcattgtatgaacatttctatctctcaagtgaagaactcaattatagg
attcaccttaaaggacttacagggacagccggcaaaataagcagcatcagccaaccagga
aatgattttagcacaaaggatggagacaacgacaaatgtatttgcaaatgttcacaaatg
ctaacaggaggctggtggtttgatgcatgtggtccttccaacttgaacggaatgtactat
ccacagaggcagaacacaaataagttcaacggcattaaatggtactactggaaaggctca
ggctattcgctcaaggccacaaccatgatgatccgaccagcagatttctaa

DBGET integrated database retrieval system