KEGG   Homo sapiens (human): 7423
Entry
7423              CDS       T01001                                 
Symbol
VEGFB, VEGFL, VRF
Name
(RefSeq) vascular endothelial growth factor B
  KO
K16858  vascular endothelial growth factor B
Organism
hsa  Homo sapiens (human)
Pathway
hsa04010  MAPK signaling pathway
hsa04014  Ras signaling pathway
hsa04015  Rap1 signaling pathway
hsa04020  Calcium signaling pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04926  Relaxin signaling pathway
hsa04933  AGE-RAGE signaling pathway in diabetic complications
hsa05200  Pathways in cancer
Drug target
Aflibercept: D09574<JP/US>
Aflibercept beta: D10819<JP>
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    7423 (VEGFB)
   04014 Ras signaling pathway
    7423 (VEGFB)
   04015 Rap1 signaling pathway
    7423 (VEGFB)
   04020 Calcium signaling pathway
    7423 (VEGFB)
   04151 PI3K-Akt signaling pathway
    7423 (VEGFB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7423 (VEGFB)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    7423 (VEGFB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    7423 (VEGFB)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    7423 (VEGFB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:hsa04052]
    7423 (VEGFB)
Cytokines and growth factors [BR:hsa04052]
 Growth factors
  Growth factors (RTK binding)
   7423 (VEGFB)
SSDB
Motif
Pfam: PDGF
Other DBs
NCBI-GeneID: 7423
NCBI-ProteinID: NP_003368
OMIM: 601398
HGNC: 12681
Ensembl: ENSG00000173511
Pharos: P49765(Tclin)
UniProt: P49765 Q7LAP4
Structure
Position
11:64234584..64239264
AA seq 207 aa
MSPLLRRLLLAALLQLAPAQAPVSQPDAPGHQRKVVSWIDVYTRATCQPREVVVPLTVEL
MGTVAKQLVPSCVTVQRCGGCCPDDGLECVPTGQHQVRMQILMIRYPSSQLGEMSLEEHS
QCECRPKKKDSAVKPDRAATPHHRPQPRSVPGWDSAPGAPSPADITHPTPAPGPSAHAAP
STTSALTPGPAAAAADAAASSVAKGGA
NT seq 624 nt   +upstreamnt  +downstreamnt
atgagccctctgctccgccgcctgctgctcgccgcactcctgcagctggcccccgcccag
gcccctgtctcccagcctgatgcccctggccaccagaggaaagtggtgtcatggatagat
gtgtatactcgcgctacctgccagccccgggaggtggtggtgcccttgactgtggagctc
atgggcaccgtggccaaacagctggtgcccagctgcgtgactgtgcagcgctgtggtggc
tgctgccctgacgatggcctggagtgtgtgcccactgggcagcaccaagtccggatgcag
atcctcatgatccggtacccgagcagtcagctgggggagatgtccctggaagaacacagc
cagtgtgaatgcagacctaaaaaaaaggacagtgctgtgaagccagacagggctgccact
ccccaccaccgtccccagccccgttctgttccgggctgggactctgcccccggagcaccc
tccccagctgacatcacccatcccactccagccccaggcccctctgcccacgctgcaccc
agcaccaccagcgccctgacccccggacctgccgctgccgctgccgacgccgcagcttcc
tccgttgccaagggcggggcttag

DBGET integrated database retrieval system