KEGG   Homo sapiens (human): 7433
Entry
7433              CDS       T01001                                 

Gene name
VIPR1, HVR1, II, PACAP-R-2, PACAP-R2, RDC1, V1RG, VAPC1, VIP-R-1, VIPR, VIRG, VPAC1, VPAC1R, VPCAP1R
Definition
(RefSeq) vasoactive intestinal peptide receptor 1
  KO
K04589  vasoactive intestinal peptide receptor 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7433 (VIPR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7433 (VIPR1)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    7433 (VIPR1)
SSDB
Motif
Pfam: 7tm_2 HRM Dicty_CAR Insulin_TMD
Other DBs
NCBI-GeneID: 7433
NCBI-ProteinID: NP_004615
OMIM: 192321
HGNC: 12694
Ensembl: ENSG00000114812
Vega: OTTHUMG00000131792
Pharos: P32241(Tbio)
UniProt: P32241
Position
3p22.1
AA seq 457 aa
MRPPSPLPARWLCVLAGALAWALGPAGGQAARLQEECDYVQMIEVQHKQCLEEAQLENET
IGCSKMWDNLTCWPATPRGQVVVLACPLIFKLFSSIQGRNVSRSCTDEGWTHLEPGPYPI
ACGLDDKAASLDEQQTMFYGSVKTGYTIGYGLSLATLLVATAILSLFRKLHCTRNYIHMH
LFISFILRAAAVFIKDLALFDSGESDQCSEGSVGCKAAMVFFQYCVMANFFWLLVEGLYL
YTLLAVSFFSERKYFWGYILIGWGVPSTFTMVWTIARIHFEDYGCWDTINSSLWWIIKGP
ILTSILVNFILFICIIRILLQKLRPPDIRKSDSSPYSRLARSTLLLIPLFGVHYIMFAFF
PDNFKPEVKMVFELVVGSFQGFVVAILYCFLNGEVQAELRRKWRRWHLQGVLGWNPKYRH
PSGGSNGATCSTQVSMLTRVSPGARRSSSFQAEVSLV
NT seq 1374 nt   +upstreamnt  +downstreamnt
atgcgcccgccaagtccgctgcccgcccgctggctatgcgtgctggcaggcgccctcgcc
tgggcccttgggccggcgggcggccaggcggccaggctgcaggaggagtgtgactatgtg
cagatgatcgaggtgcagcacaagcagtgcctggaggaggcccagctggagaatgagaca
ataggctgcagcaagatgtgggacaacctcacctgctggccagccacccctcggggccag
gtagttgtcttggcctgtcccctcatcttcaagctcttctcctccattcaaggccgcaat
gtaagccgcagctgcaccgacgaaggctggacgcacctggagcctggcccgtaccccatt
gcctgtggtttggatgacaaggcagcgagtttggatgagcagcagaccatgttctacggt
tctgtgaagaccggctacaccattggctacggcctgtccctcgccacccttctggtcgcc
acagctatcctgagcctgttcaggaagctccactgcacgcggaactacatccacatgcac
ctcttcatatccttcatcctgagggctgccgctgtcttcatcaaagacttggccctcttc
gacagcggggagtcggaccagtgctccgagggctcggtgggctgtaaggcagccatggtc
tttttccaatattgtgtcatggctaacttcttctggctgctggtggagggcctctacctg
tacaccctgcttgccgtctccttcttctctgagcggaagtacttctgggggtacatactc
atcggctggggggtacccagcacattcaccatggtgtggaccatcgccaggatccatttt
gaggattatgggtgctgggacaccatcaactcctcactgtggtggatcataaagggcccc
atcctcacctccatcttggtaaacttcatcctgtttatttgcatcatccgaatcctgctt
cagaaactgcggcccccagatatcaggaagagtgacagcagtccatactcaaggctagcc
aggtccacactcctgctgatccccctgtttggagtacactacatcatgttcgccttcttt
ccggacaattttaagcctgaagtgaagatggtctttgagctcgtcgtggggtctttccag
ggttttgtggtggctatcctctactgcttcctcaatggtgaggtgcaggcggagctgagg
cggaagtggcggcgctggcacctgcagggcgtcctgggctggaaccccaaataccggcac
ccgtcgggaggcagcaacggcgccacgtgcagcacgcaggtttccatgctgacccgcgtc
agcccaggtgcccgccgctcctccagcttccaagccgaagtctccctggtctga

DBGET integrated database retrieval system