KEGG   Homo sapiens (human): 7434Help
Entry
7434              CDS       T01001                                 

Gene name
VIPR2, C16DUPq36.3, DUP7q36.3, PACAP-R-3, PACAP-R3, VIP-R-2, VPAC2, VPAC2R, VPCAP2R
Definition
(RefSeq) vasoactive intestinal peptide receptor 2
  KO
K04590  vasoactive intestinal peptide receptor 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04024  cAMP signaling pathway
hsa04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    7434 (VIPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    7434 (VIPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    7434 (VIPR2)
G protein-coupled receptors [BR:hsa04030]
 Secretin receptor family
  Gut peptide
   Vasoactive intestinal polypeptide (VIP) and pituitary adenyl cyclase-activating peptide (PACAP)
    7434 (VIPR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_2 HRM
Motif
Other DBs
NCBI-GeneID: 7434
NCBI-ProteinID: NP_003373
OMIM: 601970
HGNC: 12695
Ensembl: ENSG00000106018
Vega: OTTHUMG00000151446
Pharos: P41587(Tchem)
UniProt: P41587 X5D7Q6
Structure
PDB: 

Position
7q36.3
AA seq 438 aa AA seqDB search
MRTLLPPALLTCWLLAPVNSIHPECRFHLEIQEEETKCAELLRSQTEKHKACSGVWDNIT
CWRPANVGETVTVPCPKVFSNFYSKAGNISKNCTSDGWSETFPDFVDACGYSDPEDESKI
TFYILVKAIYTLGYSVSLMSLATGSIILCLFRKLHCTRNYIHLNLFLSFILRAISVLVKD
DVLYSSSGTLHCPDQPSSWVGCKLSLVFLQYCIMANFFWLLVEGLYLHTLLVAMLPPRRC
FLAYLLIGWGLPTVCIGAWTAARLYLEDTGCWDTNDHSVPWWVIRIPILISIIVNFVLFI
SIIRILLQKLTSPDVGGNDQSQYKRLAKSTLLLIPLFGVHYMVFAVFPISISSKYQILFE
LCLGSFQGLVVAVLYCFLNSEVQCELKRKWRSRCPTPSASRDYRVCGSSFSRNGSEGALQ
FHRGSRAQSFLQTETSVI
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atgcggacgctgctgcctcccgcgctgctgacctgctggctgctcgcccccgtgaacagc
attcacccagaatgccgatttcatctggaaatacaggaggaagaaacaaaatgtgcagag
cttctgaggtctcaaacagaaaaacacaaagcctgcagtggcgtctgggacaacatcacg
tgctggcggcctgccaatgtgggagagaccgtcacggtgccctgcccaaaagtcttcagc
aatttttacagcaaagcaggaaacataagcaaaaactgtacgagtgacggatggtcagag
acgttcccagatttcgtcgatgcctgtggctacagcgacccggaggatgagagcaagatc
acgttttatattctggtgaaggccatttataccctgggctacagtgtctctctgatgtct
cttgcaacaggaagcataattctgtgcctcttcaggaagctgcactgcaccaggaattac
atccacctgaacctgttcctgtccttcatcctgagagccatctcagtgctggtcaaggac
gacgttctctactccagctctggcacgttgcactgccctgaccagccatcctcctgggtg
ggctgcaagctgagcctggtcttcctgcagtactgcatcatggccaacttcttctggctg
ctggtggaggggctctacctccacaccctcctggtggccatgctcccccctagaaggtgc
ttcctggcctacctcctgatcggatggggcctccccaccgtctgcatcggtgcatggact
gcggccaggctctacttagaagacaccggttgctgggatacaaacgaccacagtgtgccc
tggtgggtcatacgaataccgattttaatttccatcatcgtcaattttgtccttttcatt
agtattatacgaattttgctgcagaagttaacatccccagatgtcggcggcaacgaccag
tctcagtacaagaggctggccaagtccacgctcctgcttatcccgctgttcggcgtccac
tacatggtgtttgccgtgtttcccatcagcatctcctccaaataccagatactgtttgag
ctgtgcctcgggtcgttccagggcctggtggtggccgtcctctactgtttcctgaacagt
gaggtgcagtgcgagctgaagcgaaaatggcgaagccggtgcccgaccccgtccgcgagc
cgggattacagggtctgcggttcctccttctcccgcaacggctcggagggcgccctgcag
ttccaccgcggctcccgcgcccagtccttcctgcaaacggagacctcggtcatctag

DBGET integrated database retrieval system