KEGG   Homo sapiens (human): 7441
Entry
7441              CDS       T01001                                 

Gene name
VPREB1, CD179a, IGI, IGVPB, VPREB
Definition
(RefSeq) V-set pre-B cell surrogate light chain 1
  KO
K06553  pre-B lymphocyte gene
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:hsa04090]
    7441 (VPREB1)
CD molecules [BR:hsa04090]
 Proteins
  7441 (VPREB1)
SSDB
Motif
Pfam: V-set Ig_3 I-set DUF4861
Other DBs
NCBI-GeneID: 7441
NCBI-ProteinID: NP_009059
OMIM: 605141
HGNC: 12709
Ensembl: ENSG00000169575
Vega: OTTHUMG00000151042
Pharos: P12018(Tbio)
IMGT: VPREB1
UniProt: P12018
Structure
PDB: 
3BJ9 2H3N 2H32

Position
22q11.22
AA seq 145 aa
MSWAPVLLMLFVYCTGCGPQPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQR
PGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGAR
SSEKEEREREWEEEMEPTAARTRVP
NT seq 438 nt   +upstreamnt  +downstreamnt
atgtcctgggctcctgtcctgctcatgctgtttgtctactgcacaggttgtggtcctcag
ccggtgctgcatcagccgccggccatgtcctcggcccttggaaccacaatccgcctcacc
tgcaccctgaggaacgaccatgacatcggtgtgtacagcgtctactggtaccagcagagg
ccgggccaccctcccaggttcctgctgagatatttctcacaatcagacaagagccagggc
ccccaggtcccccctcgcttctctggatccaaagatgtggccaggaacagggggtatttg
agcatctctgagctgcagcctgaggacgaggctatgtattactgtgctatgggggcccgc
agctcggagaaggaggagagggagagggagtgggaggaagaaatggaacccactgcagcc
aggacacgtgtcccttga

DBGET integrated database retrieval system