KEGG   Homo sapiens (human): 7444Help
Entry
7444              CDS       T01001                                 

Gene name
VRK2
Definition
(RefSeq) VRK serine/threonine kinase 2
  KO
K08816  vaccinia related kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7444 (VRK2)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     7444 (VRK2)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CK1 group
  VRK family
   7444 (VRK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal VP_N-CPKC
Motif
Other DBs
NCBI-GeneID: 7444
NCBI-ProteinID: NP_001123952
OMIM: 602169
HGNC: 12719
Ensembl: ENSG00000028116
Vega: OTTHUMG00000129348
Pharos: Q86Y07(Tbio)
UniProt: Q86Y07
Structure
PDB: 

Position
2p16.1
AA seq 508 aa AA seqDB search
MPPKRNEKYKLPIPFPEGKVLDDMEGNQWVLGKKIGSGGFGLIYLAFPTNKPEKDARHVV
KVEYQENGPLFSELKFYQRVAKKDCIKKWIERKQLDYLGIPLFYGSGLTEFKGRSYRFMV
MERLGIDLQKISGQNGTFKKSTVLQLGIRMLDVLEYIHENEYVHGDIKAANLLLGYKNPD
QVYLADYGLSYRYCPNGNHKQYQENPRKGHNGTIEFTSLDAHKGVALSRRSDVEILGYCM
LRWLCGKLPWEQNLKDPVAVQTAKTNLLDELPQSVLKWAPSGSSCCEIAQFLVCAHSLAY
DEKPNYQALKKILNPHGIPLGPLDFSTKGQSINVHTPNSQKVDSQKAATKQVNKAHNRLI
EKKVHSERSAESCATWKVQKEEKLIGLMNNEAAQESTRRRQKYQESQEPLNEVNSFPQKI
SYTQFPNSFYEPHQDFTSPDIFKKSRSPSWYKYTSTVSTGITDLESSTGLWPTISQFTLS
EETNADVYYYRIIIPVLLMLVFLALFFL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgccaccaaaaagaaatgaaaaatacaaacttcctattccatttccagaaggcaaggtt
ctggatgatatggaaggcaatcagtgggtactgggcaagaagattggctctggaggattt
ggattgatatatttagctttccccacaaataaaccagagaaagatgcaagacatgtagta
aaagtggaatatcaagaaaatggcccgttattttcagaacttaaattttatcagagagtt
gcaaaaaaagactgtatcaaaaagtggatagaacgcaaacaacttgattatttaggaatt
cctctgttttatggatctggtctgactgaattcaagggaagaagttacagatttatggta
atggaaagactaggaatagatttacagaagatctcaggccagaatggtacctttaaaaag
tcaactgtcctgcaattaggtatccgaatgttggatgtactggaatatatacatgaaaat
gaatatgttcatggtgatataaaagcagcaaatctacttttgggttacaaaaatccagac
caggtttatcttgcagattatggactttcctacagatattgtcccaatgggaaccacaaa
cagtatcaggaaaatcctagaaaaggccataatgggacaatagagtttaccagcttggat
gcccacaagggagtagccttgtccagacgaagtgacgttgagatcctcggctactgcatg
ctgcggtggttgtgtgggaaacttccctgggaacagaacctgaaggaccctgtggctgtg
cagactgctaaaacaaatctgttggacgagctcccccagtcagtgcttaaatgggctcct
tctggaagcagttgctgtgaaatagcccaatttttggtatgtgctcatagtttagcatat
gatgaaaagccaaactatcaagccctcaagaaaattttgaaccctcatggaataccttta
ggaccactggacttttccacaaaaggacagagtataaatgtccatactccaaacagtcaa
aaagttgattcacaaaaggctgcaacaaagcaagtcaacaaggcacacaataggttaatc
gaaaaaaaagtccacagtgagagaagcgctgagtcctgtgcaacatggaaagtgcagaaa
gaggagaaactgattggattgatgaacaatgaagcagctcaggaaagcacaaggagaaga
cagaaatatcaagagtctcaagaacctttgaatgaagtaaacagtttcccacaaaaaatc
agctatacacaattcccaaactcattttatgagcctcatcaagattttaccagtccagat
atattcaagaagtcaagatctccatcttggtataaatacacttccacagtcagcacgggg
atcacagacttagaaagttcaactggactttggcctacaatttcccagtttactcttagt
gaagagacaaacgcagatgtttattattatcgcatcatcatacctgtccttttgatgtta
gtatttcttgctttattttttctctga

DBGET integrated database retrieval system