KEGG   Homo sapiens (human): 7448Help
Entry
7448              CDS       T01001                                 

Gene name
VTN, V75, VN, VNT
Definition
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
hsa  Homo sapiens (human)
Pathway
hsa04151  PI3K-Akt signaling pathway
hsa04510  Focal adhesion
hsa04512  ECM-receptor interaction
hsa04610  Complement and coagulation cascades
hsa05165  Human papillomavirus infection
hsa05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    7448 (VTN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    7448 (VTN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    7448 (VTN)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    7448 (VTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    7448 (VTN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    7448 (VTN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   7448 (VTN)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate / Haparin
  Extracellular matrix molecules
   7448 (VTN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hemopexin Somatomedin_B
Motif
Other DBs
NCBI-GeneID: 7448
NCBI-ProteinID: NP_000629
OMIM: 193190
HGNC: 12724
Ensembl: ENSG00000109072
Vega: OTTHUMG00000132500
Pharos: P04004(Tbio)
UniProt: P04004 D9ZGG2
Structure
PDB: 

Position
17q11.2
AA seq 478 aa AA seqDB search
MAPLRPLLILALLAWVALADQESCKGRCTEGFNVDKKCQCDELCSYYQSCCTDYTAECKP
QVTRGDVFTMPEDEYTVYDDGEEKNNATVHEQVGGPSLTSDLQAQSKGNPEQTPVLKPEE
EAPAPEVGASKPEGIDSRPETLHPGRPQPPAEEELCSGKPFDAFTDLKNGSLFAFRGQYC
YELDEKAVRPGYPKLIRDVWGIEGPIDAAFTRINCQGKTYLFKGSQYWRFEDGVLDPDYP
RNISDGFDGIPDNVDAALALPAHSYSGRERVYFFKGKQYWEYQFQHQPSQEECEGSSLSA
VFEHFAMMQRDSWEDIFELLFWGRTSAGTRQPQFISRDWHGVPGQVDAAMAGRIYISGMA
PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQNSRRPSRATWLSLFSSEESNLGANNYDDY
RMDWLVPATCEPIQSVFFFSGDKYYRVNLRTRRVDTVDPPYPRSIAQYWLGCPAPGHL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcacccctgagaccccttctcatactggccctgctggcatgggttgctctggctgac
caagagtcatgcaagggccgctgcactgagggcttcaacgtggacaagaagtgccagtgt
gacgagctctgctcttactaccagagctgctgcacagactatacggctgagtgcaagccc
caagtgactcgcggggatgtgttcactatgccggaggatgagtacacggtctatgacgat
ggcgaggagaaaaacaatgccactgtccatgaacaggtggggggcccctccctgacctct
gacctccaggcccagtccaaagggaatcctgagcagacacctgttctgaaacctgaggaa
gaggcccctgcgcctgaggtgggcgcctctaagcctgaggggatagactcaaggcctgag
acccttcatccagggagacctcagcccccagcagaggaggagctgtgcagtgggaagccc
ttcgacgccttcaccgacctcaagaacggttccctctttgccttccgagggcagtactgc
tatgaactggacgaaaaggcagtgaggcctgggtaccccaagctcatccgagatgtctgg
ggcatcgagggccccatcgatgccgccttcacccgcatcaactgtcaggggaagacctac
ctcttcaagggtagtcagtactggcgctttgaggatggtgtcctggaccctgattacccc
cgaaatatctctgacggcttcgatggcatcccggacaacgtggatgcagccttggccctc
cctgcccatagctacagtggccgggagcgggtctacttcttcaaggggaaacagtactgg
gagtaccagttccagcaccagcccagtcaggaggagtgtgaaggcagctccctgtcggct
gtgtttgaacactttgccatgatgcagcgggacagctgggaggacatcttcgagcttctc
ttctggggcagaacctctgctggtaccagacagccccagttcattagccgggactggcac
ggtgtgccagggcaagtggacgcagccatggctggccgcatctacatctcaggcatggca
ccccgcccctccttggccaagaaacaaaggtttaggcatcgcaaccgcaaaggctaccgt
tcacaacgaggccacagccgtggccgcaaccagaactcccgccggccatcccgcgccacg
tggctgtccttgttctccagtgaggagagcaacttgggagccaacaactatgatgactac
aggatggactggcttgtgcctgccacctgtgaacccatccagagtgtcttcttcttctct
ggagacaagtactaccgagtcaatcttcgcacacggcgagtggacactgtggaccctccc
tacccacgctccatcgctcagtactggctgggctgcccagctcctggccatctgtag

DBGET integrated database retrieval system