KEGG   Homo sapiens (human): 7458Help
Entry
7458              CDS       T01001                                 

Gene name
EIF4H, WBSCR1, WSCR1, eIF-4H
Definition
(RefSeq) eukaryotic translation initiation factor 4H
  KO
K24086  translation initiation factor 4H
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7458 (EIF4H)
   03012 Translation factors [BR:hsa03012]
    7458 (EIF4H)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     7458 (EIF4H)
Translation factors [BR:hsa03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    7458 (EIF4H)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 eIF-4B
Motif
Other DBs
NCBI-GeneID: 7458
NCBI-ProteinID: NP_071496
OMIM: 603431
HGNC: 12741
Ensembl: ENSG00000106682
Vega: OTTHUMG00000023025
Pharos: Q15056(Tchem)
UniProt: Q15056
Position
7q11.23
AA seq 248 aa AA seqDB search
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcgacacctacgacgatcgggcctacagcagcttcggcggcggcagaggg
tcccgcggcagtgctggtggccatggttcccgtagccagaaggagttgcccacagagccc
ccctacacagcatacgtaggaaatctacctttcaatacggttcagggcgacatagatgct
atctttaaggatctcagcataaggagtgtacggctagtcagagacaaagacacagataaa
tttaaaggattctgctatgtagaattcgatgaagtggattcccttaaggaagccttgaca
tacgatggtgcactgttgggcgatcggtcacttcgtgtggacattgcagaaggcagaaaa
caagataaaggtggctttggattcagaaaaggtggaccagatgacagaggaatgggtagc
tctcgagaatctagaggtggatgggattcccgggatgacttcaattctggcttcagggat
gacttcttagggggcaggggaggtagtcgcccaggcgaccggcgaacaggcccccccatg
ggcagccgcttcagagatggccctcccctccgtggatccaacatggatttcagagaaccc
acagaagaggaaagagcacagagaccacgactccagcttaaacctcgaacagtcgcgacg
cccctcaatcaagtagccaatcccaactctgctatcttcgggggtgccaggcctagagag
gaagtcgttcaaaaggagcaagaatga

DBGET integrated database retrieval system