KEGG   Homo sapiens (human): 7458Help
Entry
7458              CDS       T01001                                 

Gene name
EIF4H, WBSCR1, WSCR1, eIF-4H
Definition
(RefSeq) eukaryotic translation initiation factor 4H
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
SSDB OrthologParalogGFIT
Motif
Pfam: RRM_1 eIF-4B
Motif
Other DBs
NCBI-GeneID: 7458
NCBI-ProteinID: NP_071496
OMIM: 603431
HGNC: 12741
Ensembl: ENSG00000106682
Vega: OTTHUMG00000023025
Pharos: Q15056(Tchem)
UniProt: Q15056
Position
7q11.23
AA seq 248 aa AA seqDB search
MADFDTYDDRAYSSFGGGRGSRGSAGGHGSRSQKELPTEPPYTAYVGNLPFNTVQGDIDA
IFKDLSIRSVRLVRDKDTDKFKGFCYVEFDEVDSLKEALTYDGALLGDRSLRVDIAEGRK
QDKGGFGFRKGGPDDRGMGSSRESRGGWDSRDDFNSGFRDDFLGGRGGSRPGDRRTGPPM
GSRFRDGPPLRGSNMDFREPTEEERAQRPRLQLKPRTVATPLNQVANPNSAIFGGARPRE
EVVQKEQE
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcggacttcgacacctacgacgatcgggcctacagcagcttcggcggcggcagaggg
tcccgcggcagtgctggtggccatggttcccgtagccagaaggagttgcccacagagccc
ccctacacagcatacgtaggaaatctacctttcaatacggttcagggcgacatagatgct
atctttaaggatctcagcataaggagtgtacggctagtcagagacaaagacacagataaa
tttaaaggattctgctatgtagaattcgatgaagtggattcccttaaggaagccttgaca
tacgatggtgcactgttgggcgatcggtcacttcgtgtggacattgcagaaggcagaaaa
caagataaaggtggctttggattcagaaaaggtggaccagatgacagaggaatgggtagc
tctcgagaatctagaggtggatgggattcccgggatgacttcaattctggcttcagggat
gacttcttagggggcaggggaggtagtcgcccaggcgaccggcgaacaggcccccccatg
ggcagccgcttcagagatggccctcccctccgtggatccaacatggatttcagagaaccc
acagaagaggaaagagcacagagaccacgactccagcttaaacctcgaacagtcgcgacg
cccctcaatcaagtagccaatcccaactctgctatcttcgggggtgccaggcctagagag
gaagtcgttcaaaaggagcaagaatga

DBGET integrated database retrieval system