KEGG   Homo sapiens (human): 746
Entry
746               CDS       T01001                                 
Symbol
TMEM258, C11orf10, Kud, Kuduk
Name
(RefSeq) transmembrane protein 258
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Ost5 Phage_holin_3_3 DUF6512
Other DBs
NCBI-GeneID: 746
NCBI-ProteinID: NP_055021
OMIM: 617615
HGNC: 1164
Ensembl: ENSG00000134825
Pharos: P61165(Tdark)
UniProt: P61165
Structure
Position
11:complement(61788949..61792599)
AA seq 79 aa
MELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIYKELLISLVA
SLFMGFGVLFLLLWVGIYV
NT seq 240 nt   +upstreamnt  +downstreamnt
atggagctcgaggccatgagcagatataccagcccagtgaacccagctgtcttcccccat
ctgaccgtggtgcttttggccattggcatgttcttcaccgcctggttcttcgtttacgag
gtcacctctaccaagtacactcgtgatatctataaagagctcctcatctccttagtggcc
tcactcttcatgggctttggagtcctcttcctgctgctctgggttggcatctacgtgtga

DBGET integrated database retrieval system