KEGG   Homo sapiens (human): 7461
Entry
7461              CDS       T01001                                 
Symbol
CLIP2, CLIP, CLIP-115, CYLN2, WBSCR3, WBSCR4, WSCR3, WSCR4
Name
(RefSeq) CAP-Gly domain containing linker protein 2
  KO
K10422  CAP-Gly domain-containing linker protein 2
Organism
hsa  Homo sapiens (human)
Disease
H01439  Williams-Beuren syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    7461 (CLIP2)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Cytoplasmic linker proteins (CLIPs)
     7461 (CLIP2)
SSDB
Motif
Pfam: CAP_GLY Sas10
Other DBs
NCBI-GeneID: 7461
NCBI-ProteinID: NP_003379
OMIM: 603432
HGNC: 2586
Ensembl: ENSG00000106665
Pharos: Q9UDT6(Tbio)
UniProt: Q9UDT6 A0A140VJG6
Structure
Position
7:74289407..74405935
AA seq 1046 aa
MQKPSGLKPPGRGGKHSSPMGRTSTGSASSSAAVAASSKEGSPLHKQSSGPSSSPAAAAA
PEKPGPKAAEVGDDFLGDFVVGERVWVNGVKPGVVQYLGETQFAPGQWAGVVLDDPVGKN
DGAVGGVRYFECPALQGIFTRPSKLTRQPTAEGSGSDAHSVESLTAQNLSLHSGTATPPL
TSRVIPLRESVLNSSVKTGNESGSNLSDSGSVKRGEKDLRLGDRVLVGGTKTGVVRYVGE
TDFAKGEWCGVELDEPLGKNDGAVAGTRYFQCPPKFGLFAPIHKVIRIGFPSTSPAKAKK
TKRMAMGVSALTHSPSSSSISSVSSVASSVGGRPSRSGLLTETSSRYARKISGTTALQEA
LKEKQQHIEQLLAERDLERAEVAKATSHICEVEKEIALLKAQHEQYVAEAEEKLQRARLL
VESVRKEKVDLSNQLEEERRKVEDLQFRVEEESITKGDLETQTQLEHARIGELEQSLLLE
KAQAERLLRELADNRLTTVAEKSRVLQLEEELTLRRGEIEELQQCLLHSGPPPPDHPDAA
EILRLRERLLSASKEHQRESGVLRDKYEKALKAYQAEVDKLRAANEKYAQEVAGLKDKVQ
QATSENMGLMDNWKSKLDSLASDHQKSLEDLKATLNSGPGAQQKEIGELKAVMEGIKMEH
QLELGNLQAKHDLETAMHVKEKEALREKLQEAQEELAGLQRHWRAQLEVQASQHRLELQE
AQDQRRDAELRVHELEKLDVEYRGQAQAIEFLKEQISLAEKKMLDYERLQRAEAQGKQEV
ESLREKLLVAENRLQAVEALCSSQHTHMIESNDISEETIRTKETVEGLQDKLNKRDKEVT
ALTSQTEMLRAQVSALESKCKSGEKKVDALLKEKRRLEAELETVSRKTHDASGQLVLISQ
ELLRKERSLNELRVLLLEANRHSPGPERDLSREVHKAEWRIKEQKLKDDIRGLREKLTGL
DKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDK
AQTIGNSGSANGIHQQDKAQKQEDKH
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgcagaagcccagcggcctgaagccccccggccgtggggggaagcactccagccccatg
ggccggacatctactgggtcagcttcatcctcggcggcggtggccgctagctccaaggaa
ggctccccactgcacaaacagtcatctggaccctcctcctccccggccgcagctgctgcc
cccgagaagccgggccccaaggcggcggaagtgggggatgacttcctgggggactttgtg
gtgggcgagcgggtgtgggtgaacggcgtgaagccaggcgtggtgcagtatctgggagag
acgcagttcgcaccgggccagtgggctggcgtggtgctggacgacccggtgggcaagaat
gatggcgcggtgggcggcgtgcgctacttcgagtgcccggccctccagggtatcttcacg
cggccctccaagctgacccggcagcccacggccgagggctcggggagtgatgcccactcc
gtggagtcgctgactgcccagaacctgtcattgcattcgggcacggccacgcccccgctg
accagccgcgtcatccccctgcgggagagcgtcctcaacagctccgtgaagactggcaac
gagtcgggatccaacctctcagacagcggctctgtgaagcggggcgaaaaggacctgcgc
ctgggggaccgcgtgctggttggcgggacgaagactggcgtggtgcggtacgtgggggag
acagactttgccaagggcgagtggtgtggcgtggagctggacgagccccttgggaagaat
gatggggcggtggcgggcaccaggtacttccagtgcccacccaagtttggtctcttcgcg
cccatccacaaagtgatccgtatcggcttcccatctaccagcccagccaaggccaagaag
accaagcgtatggccatgggtgtgtcagcactgacccacagtcccagcagttcctccatc
agctccgtcagctctgtggcctcctccgtggggggtcggcccagccgcagtggcctgctc
acggagacctcttcacgctacgcccgcaagatctcgggcaccacggccttgcaggaggca
ctgaaggagaagcagcagcacattgagcagctgctggctgaacgagacctggaacgggct
gaggtggccaaggccacaagccacatctgcgaggtggagaaggagattgccctgctcaag
gcacagcatgagcagtatgttgcagaagccgaggagaagctgcagcgagcccggctgctc
gtggagagcgtgcggaaagagaaggtggacctgtccaaccagctggaggaggagaggagg
aaggtggaggatctgcagttccgcgtggaggaggagtccatcaccaagggagacctggag
acccagacgcagctggagcacgcgcgcattggggagctggaacagagcctgctactggag
aaggcgcaggccgagcggctgctccgagaattagcggacaacaggctgaccacagtggcc
gagaagtcgcgcgtgctgcagctggaggaggagctcaccctgcgccgaggtgaaatcgag
gagctccagcagtgcctgttgcactcgggtcccccacctccggaccacccagacgccgcc
gagatcctgcggctacgggagcggctgctctcggccagcaaggaacaccagagggagagt
ggggtgctgcgggataaatacgagaaggccctgaaggcctaccaggcggaggtggacaag
ctccgcgcggccaacgagaagtacgcacaggaggtggcgggcctgaaggacaaggttcag
caggccaccagcgagaacatggggctaatggacaactggaaatccaagctggactcgctg
gcctcggaccaccagaagtccctggaggacctcaaagccaccctgaactcgggcccaggc
gcccagcagaaggagatcggcgagctgaaggcagtgatggagggcatcaagatggagcac
cagctggagctgggtaacttgcaggccaagcatgacctggagaccgccatgcacgtgaag
gagaaggaggccctgcgagagaagctgcaggaggcccaggaggagctggctgggctgcag
cggcactggcgggcccagctggaggtgcaagccagccagcaccggctggagctgcaggag
gcccaggaccagcgccgggatgccgagctgcgtgtgcacgagctggaaaaactggacgtg
gagtaccggggccaggcgcaggctatcgagttcctcaaggagcagatctcgctggccgag
aagaagatgttggactacgagcggctgcagcgggcagaagcccagggcaaacaggaggtc
gagagtttgcgggagaagctcctggtggctgagaacagactccaggcggtcgaggccctg
tgctcctcccagcacacccacatgattgagtcgaatgacatttcagaggagacgatcagg
acgaaggaaactgtggagggcctgcaggacaagctgaacaagagggacaaagaggtgaca
gccttgacctcccagaccgagatgctcagggcccaagtaagtgcgctggagagcaagtgt
aagtcaggcgagaagaaggtggacgccctcctgaaggagaagcggcgcctggaggcagag
ctggagaccgtgtcccggaagacccatgacgcctcgggccagctagtcctcatcagccag
gagctgctgcggaaggagcggagcctgaacgaactgcgggtgttgctgctggaggccaat
cgtcactccccagggccggagagggacctgagccgtgaggtacacaaggctgagtggcgg
atcaaggagcagaaactcaaggatgacatccggggcctgcgtgaaaagctgaccgggctg
gacaaagagaaatccctgtcggatcagaggcgctactccctcatcgaccggtcctcggcg
cccgagcttctgcggctgcagcaccagctgatgagcacggaggacgccctgcgggatgcg
ctggaccaggctcagcaggtggagaagctgatggaggccatgaggagctgccctgacaag
gcccagaccatcggcaattccggttctgcaaacggcatccaccagcaggacaaagctcag
aaacaagaggacaagcactga

DBGET integrated database retrieval system