KEGG   Homo sapiens (human): 7469Help
Entry
7469              CDS       T01001                                 

Gene name
NELFA, NELF-A, P/OKcl.15, WHSC2
Definition
(RefSeq) negative elongation factor complex member A
  KO
K15179  negative elongation factor A
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:hsa03021]
    7469 (NELFA)
Transcription machinery [BR:hsa03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    NELF complex
     7469 (NELFA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CathepsinC_exc
Motif
Other DBs
NCBI-GeneID: 7469
NCBI-ProteinID: NP_005654
OMIM: 606026
HGNC: 12768
Ensembl: ENSG00000185049
Vega: OTTHUMG00000089967
Pharos: Q9H3P2(Tbio)
UniProt: Q9H3P2 A0A0C4DFX9
Structure
PDB: 

Position
4p16.3
AA seq 528 aa AA seqDB search
MASMRESDTGLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLSSAVKLKLLLGT
LHLPRRTVDEMKGALMEIIQLASLDSDPWVLMVADILKSFPDTGSLNLELEEQNPNVQDI
LGELREKVGECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKPKSATLRAELLQ
KSTETAQQLKRSAGVPFHAKGRGLLRKMDTTTPLKGIPKQAPFRSPTAPSVFSPTGNRTP
IPPSRTLLRKERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKEETVVENATPDY
AAGLVSTQKLGSLNNEPALPSTSYLPSTPSVVPASSYIPSSETPPAPSSREASRPPEEPS
APSPTLPAQFKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQTPPVAMVAPQTQ
APAQQQPKKNLSLTREQMFAAQEMFKTANKVTRPEKALILGFMAGSRENPCQEQGDVIQI
KLSEHTEDLPKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNVS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccatgcgggagagcgacacgggcctgtggctgcacaacaagctgggggccacg
gacgagctgtgggcgccgcccagcatcgcgtccctgctcacggccgcggtcatcgacaac
atccgtctctgcttccatggcctctcgtcggcagtgaagctcaagttgctactcgggacg
ctgcacctcccgcgccgcacggtggacgagatgaagggcgccctaatggagatcatccag
ctcgccagcctcgactcggacccctgggtgctcatggtcgccgacatcttgaagtccttt
ccggacacaggctcgcttaacctggagctggaggagcagaatcccaacgttcaggatatt
ttgggagaacttagagaaaaggtgggtgagtgtgaagcgtctgccatgctgccactggag
tgccagtacttgaacaaaaacgccctgacgaccctcgcgggacccctcactcccccggtg
aagcattttcagttaaagcggaaacccaagagcgccacgctgcgggcggagctgctgcag
aagtccacggagaccgcccagcagttgaagcggagcgccggggtgcccttccacgccaag
ggccgggggctgctgcggaagatggacaccaccaccccactcaaaggcatcccgaagcag
gcgcccttcagaagccccacggcgcccagcgtcttcagccccacagggaaccggaccccc
atcccgccttccaggacgctgctgcggaaggaacgaggtgtgaagctgctggacatctct
gagctggatatggttggcgctggccgagaggcgaagcggagaaggaagactctcgatgcg
gaggtggtggagaagccggccaaggaggaaacggtggtggagaacgccaccccggactac
gcagccggcctggtgtccacgcagaaacttgggtccctgaacaatgagcctgcgctgccc
tccacgagctaccttccctccacgcccagcgtggttcccgcctcctcctacatccccagc
tccgagacgcccccagccccatcttcccgggaagccagccgcccaccagaggagcccagc
gccccgagccccacgttgccagcgcagttcaagcagcgggcgcccatgtacaacagcggc
ctgagccctgccacacccacgcctgcggcgcccacctcgcctctgacacccaccacacct
ccggctgtcgcccctaccactcagacacccccggttgccatggtggccccgcagacccag
gcccctgctcagcagcagcctaagaagaacctgtccctcacgagagagcagatgttcgct
gcccaggagatgttcaagacggccaacaaagtcacgcggcccgagaaggccctcatcctg
ggcttcatggccggctcccgagagaacccgtgccaggagcagggggacgtgatccagatc
aagctgagcgagcacacggaggacctgcccaaggcggacggccagggtagcacaaccatg
ctggtggacacagtgtttgagatgaactatgccacgggccagtggacgcgcttcaagaag
tacaagcccatgaccaatgtgtcctag

DBGET integrated database retrieval system