KEGG   Homo sapiens (human): 747Help
Entry
747               CDS       T01001                                 

Gene name
DAGLA, C11orf11, DAGL(ALPHA), DAGLALPHA, NSDDR
Definition
(RefSeq) diacylglycerol lipase alpha
  KO
K13806  sn1-specific diacylglycerol lipase [EC:3.1.1.-]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04723  Retrograde endocannabinoid signaling
hsa04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    747 (DAGLA)
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    747 (DAGLA)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     747 (DAGLA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lipase_3 Abhydrolase_6
Motif
Other DBs
NCBI-GeneID: 747
NCBI-ProteinID: NP_006124
OMIM: 614015
HGNC: 1165
Ensembl: ENSG00000134780
Vega: OTTHUMG00000168160
Pharos: Q9Y4D2(Tchem)
UniProt: Q9Y4D2 A0A024R517
Position
11q12.2
AA seq 1042 aa AA seqDB search
MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGR
GYLGILLSCMIAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLT
QYYTSCNDLTAKNVTLGMVVCNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTY
NLRHRLEEGQATSWSRRLKVFLCCTRTKDSQSDAYSEIAYLFAEFFRDLDIVPSDIIAGL
VLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDLKNSQEMLRYKEVCYYMLFAL
AAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCNAIAIRRHFLD
ENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAI
LSFLLRPQYPTLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQ
LLDVLQRSTKPKWRIIVGATKCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLY
PPGRIIHVVHNHPAEQCCCCEQEEPTYFAIWGDNKAFNEVIISPAMLHEHLPYVVMEGLN
KVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLPTGPPMPTGLALELPTADHRN
SSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAELQARRAPLATM
ESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNG
RLGDSPSPQVLEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILL
RAQFEPNLVPKPPRLFAGSADPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIR
TSTPTGHGASPAKQDELVISAR
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgcccgggatcgtggtgttccggcggcgctggtctgtgggcagtgatgacctcgtccta
ccggccatcttcctctttctcctgcataccacctggtttgtgatcctgtccgtggtgctc
ttcggcctggtctataacccgcacgaggcctgctccctgaacctggtggaccacggccgc
ggctacctgggcatcctgctgagctgcatgatcgctgagatggccatcatctggctgagc
atgcgcgggggcatcctctacacggagccccgtgactccatgcagtacgtgctctacgtg
cgcctggccatcctggtgatcgagttcatctacgccatcgtgggcatcgtctggctcact
cagtactacacctcctgcaacgacctcactgccaagaatgtcaccctcggaatggttgtc
tgcaactgggtagtcatcctcagtgtgtgcatcactgtcctctgcgtcttcgaccccacg
ggccgcacctttgtcaagctgagagccaccaagaggaggcagcgtaacctgcggacctac
aacctgcggcaccgcttagaggagggtcaagccaccagctggtcgcgccggctcaaagtg
ttcctctgctgcacgcggacgaaggactcccagtcagatgcctactcagaaatcgcctac
ctctttgcggagttcttccgggaccttgacattgtgccatccgacatcattgctggcctg
gtgctgctccggcagcggcagcgggccaagcgcaacgccgtgctggacgaggcaaacaat
gacatcttggccttcctgtctgggatgccggtgaccagaaacaccaagtacctcgacctc
aagaattcacaagagatgctccgctacaaagaggtctgctactacatgctctttgccctg
gctgcctacgggtggcccatgtacctgatgcggaagcccgcctgcggcctctgccaactg
gctcggtcctgctcgtgttgcctgtgtcctgcgaggccgcggttcgcccctggagtcacc
atcgaggaagacaactgctgtggctgtaatgccattgccatccggcgccacttcctggac
gagaacatgactgcggtggacatcgtctatacctcctgccatgatgcggtctatgaaacg
cccttctacgtggcggtggaccatgacaagaagaaagtggtgatcagtatccgggggacc
ctgtcccccaaggatgccctgactgacctgacgggtgatgctgagcgcctccccgtggag
gggcaccacggcacctggctgggccacaagggtatggtcctctcagctgagtacatcaag
aagaaactggagcaggagatggtcctgtcccaggcctttgggcgagacctgggccgcgga
accaaacactacggcctgattgtggtgggccactccctgggcgcgggcactgctgccatc
ctctccttccttctgcgcccacagtatccgaccctcaagtgctttgcctactccccgcca
gggggcctgctgagtgaggatgcgatggagtattccaaggagttcgtgactgctgtggtt
ctgggcaaagacctcgtccccaggattggcctctctcagctggaaggcttccgcagacag
ctcctggatgtcctgcagcgaagcaccaagcccaaatggcggatcatcgtgggggccacc
aaatgcatccccaagtcggagctgcctgaggaggtagaggtgaccaccctggccagcacg
cggctctggacccaccccagcgacctaactatagccctctcagccagcactccactctac
ccgcccggccgcatcatccacgtggtccacaaccaccctgcagagcagtgctgctgctgt
gagcaggaggagcccacatactttgccatctggggcgacaacaaggccttcaatgaggtg
atcatctcgccagccatgctgcatgagcacctgccctatgtggtcatggaggggctcaac
aaggtgctggagaactacaacaaggggaagaccgctctgctctctgcagccaaggtcatg
gtgagccctaccgaggtggacctgactcctgagctcatcttccagcagcagccactcccc
acggggccgcccatgcccactggccttgccctggagctgccgactgcagaccaccgcaac
agcagcgtcaggagcaagtcccagtctgagatgagcctggagggcttctcggaggggcgg
ctgctgtcgccagtggttgcggcggcggcccgccaggacccggtggagctgctgctgctg
tctacccaggagcggctggcggcggagctgcaggcccggcgggcaccactggccaccatg
gagagcctctcggacactgagtccctgtacagcttcgactcgcgccgctcctcaggcttc
cgcagcatccggggctcccccagcctccacgctgtgctggagcgtgatgaaggccacctc
ttctacattgaccctgccatccccgaggaaaacccatccctgagctcgcgcactgagctg
ctggcggccgacagcctgtccaagcactcacaggacacgcagcccctggaggcggccctg
ggcagtggcggcgtcactcctgagcggccccccagtgctgcggccaatgacgaggaggaa
gaggttggcggtgggggtggcgggccggcctcccgcggggagctggcgctgcacaatggg
cgcctgggggactcgcccagtcctcaggtgctggaattcgccgagttcatcgacagcctc
ttcaacctggacagcaagagcagctccttccaagacctctactgcatggtggtgcccgag
agccccaccagtgactacgctgagggccccaagtcccccagccagcaagagatcctgctc
cgtgcccagttcgagcccaacctggtgcccaagcccccacggctctttgccggctcagcc
gacccctcctcgggcatctcactctcgccctccttcccgctcagctcctcgggtgagctc
atggacctgacgcccacgggcctcagtagccaggaatgcctggcggctgacaagatccgg
acttctacccccactggccacggagccagccccgccaagcaagatgagctggtcatctca
gcacgctag

DBGET integrated database retrieval system