KEGG   Homo sapiens (human): 7482Help
Entry
7482              CDS       T01001                                 

Gene name
WNT2B, WNT13
Definition
(RefSeq) Wnt family member 2B
  KO
K00182  wingless-type MMTV integration site family, member 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05166  Human T-cell leukemia virus 1 infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00010  Mutation-inactivated PTCH1 to Hedgehog signaling pathway
N00017  Mutation-activated SMO to Hedgehog signaling pathway
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    7482 (WNT2B)
   04390 Hippo signaling pathway
    7482 (WNT2B)
   04150 mTOR signaling pathway
    7482 (WNT2B)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    7482 (WNT2B)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    7482 (WNT2B)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    7482 (WNT2B)
   05205 Proteoglycans in cancer
    7482 (WNT2B)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    7482 (WNT2B)
   05226 Gastric cancer
    7482 (WNT2B)
   05217 Basal cell carcinoma
    7482 (WNT2B)
   05224 Breast cancer
    7482 (WNT2B)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    7482 (WNT2B)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7482 (WNT2B)
   05165 Human papillomavirus infection
    7482 (WNT2B)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:hsa00536]
    7482 (WNT2B)
Glycosaminoglycan binding proteins [BR:hsa00536]
 Heparan sulfate/Haparin
  Morphogens
   7482 (WNT2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: wnt
Motif
Other DBs
NCBI-GeneID: 7482
NCBI-ProteinID: NP_078613
OMIM: 601968
HGNC: 12781
Ensembl: ENSG00000134245
Vega: OTTHUMG00000011157
Pharos: Q93097(Tbio)
UniProt: Q93097
Position
1p13.2
AA seq 391 aa AA seqDB search
MLRPGGAEEAAQLPLRRASAPVPVPSPAAPDGSRASARLGLACLLLLLLLTLPARVDTSW
WYIGALGARVICDNIPGLVSRQRQLCQRYPDIMRSVGEGAREWIRECQHQFRHHRWNCTT
LDRDHTVFGRVMLRSSREAAFVYAISSAGVVHAITRACSQGELSVCSCDPYTRGRHHDQR
GDFDWGGCSDNIHYGVRFAKAFVDAKEKRLKDARALMNLHNNRCGRTAVRRFLKLECKCH
GVSGSCTLRTCWRALSDFRRTGDYLRRRYDGAVQVMATQDGANFTAARQGYRRATRTDLV
YFDNSPDYCVLDKAAGSLGTAGRVCSKTSKGTDGCEIMCCGRGYDTTRVTRVTQCECKFH
WCCAVRCKECRNTVDVHTCKAPKKAEWLDQT
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgctgagaccgggtggtgcggaggaagctgcgcagctcccgcttcggcgcgccagcgcc
ccggtccctgtgccgtcgcccgcggcccccgacggctcccgggcttcggcccgcctaggt
cttgcctgccttctgctcctgctgctgctgacgctgccggcccgcgtagacacgtcctgg
tggtacattggggcactgggggcacgagtgatctgtgacaatatccctggtttggtgagc
cggcagcggcagctgtgccagcgttacccagacatcatgcgttcagtgggcgagggtgcc
cgagaatggatccgagagtgtcagcaccaattccgccaccaccgctggaactgtaccacc
ctggaccgggaccacaccgtctttggccgtgtcatgctcagaagtagccgagaggcagct
tttgtatatgccatctcatcagcaggggtagtccacgctattactcgcgcctgtagccag
ggtgaactgagtgtgtgcagctgtgacccctacacccgtggccgacaccatgaccagcgt
ggggactttgactggggtggctgcagtgacaacatccactacggtgtccgttttgccaag
gccttcgtggatgccaaggagaagaggcttaaggatgcccgggccctcatgaacttacat
aataaccgctgtggtcgcacggctgtgcggcggtttctgaagctggagtgtaagtgccat
ggcgtgagtggttcctgtactctgcgcacctgctggcgtgcactctcagatttccgccgc
acaggtgattacctgcggcgacgctatgatggggctgtgcaggtgatggccacccaagat
ggtgccaacttcaccgcagcccgccaaggctatcgccgtgccacccggactgatcttgtc
tactttgacaactctccagattactgtgtcttggacaaggctgcaggttccctaggcact
gcaggccgtgtctgcagcaagacatcaaaaggaacagacggttgtgaaatcatgtgctgt
ggccgagggtacgacacaactcgagtcacccgtgttacccagtgtgagtgcaaattccac
tggtgctgtgctgtacggtgcaaggaatgcagaaatactgtggacgtccatacttgcaaa
gcccccaagaaggcagagtggctggaccaaacctga

DBGET integrated database retrieval system