KEGG   Homo sapiens (human): 7490Help
Entry
7490              CDS       T01001                                 

Gene name
WT1, AWT1, GUD, NPHS4, WAGR, WIT-2, WT33
Definition
(RefSeq) Wilms tumor 1
  KO
K09234  Wilms tumor protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa05202  Transcriptional misregulation in cancer
Network
N00137  EWSR1-WT1 fusion to transcriptional activation
Disease
H00607  46,XY gonadal dysgenesis
H01657  Nephrotic syndrome
H01985  Desmoplastic small round cell tumor
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancers: Overview
   05202 Transcriptional misregulation in cancer
    7490 (WT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7490 (WT1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, GLI-like
    7490 (WT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WT1 zf-H2C2_2 zf-C2H2 zf-C2H2_4 FOXP-CC zf-C2H2_aberr zf-met zf-C2H2_jaz
Motif
Other DBs
NCBI-GeneID: 7490
NCBI-ProteinID: NP_000369
OMIM: 607102
HGNC: 12796
Ensembl: ENSG00000184937
Vega: OTTHUMG00000039556
Pharos: P19544(Tbio)
UniProt: P19544 Q6PI38 A0A1W2PQQ0
Structure
PDB: 

Position
11p13
AA seq 502 aa AA seqDB search
MDFLLLQDPASTCVPEPASQHTLRSGPGCLQQPEQQGVRDPGGIWAKLGAAEASAERLQG
RRSRGASGSEPQQMGSDVRDLNALLPAVPSLGGGGGCALPVSGAAQWAPVLDFAPPGASA
YGSLGGPAPPPAPPPPPPPPPHSFIKQEPSWGGAEPHEEQCLSAFTVHFSGQFTGTAGAC
RYGPFGPPPPSQASSGQARMFPNAPYLPSCLESQPAIRNQGYSTVTFDGTPSYGHTPSHH
AAQFPNHSFKHEDPMGQQGSLGEQQYSVPPPVYGCHTPTDSCTGSQALLLRTPYSSDNLY
QMTSQLECMTWNQMNLGATLKGHSTGYESDNHTTPILCGAQYRIHTHGVFRGIQDVRRVP
GVAPTLVRSASETSEKRPFMCAYPGCNKRYFKLSHLQMHSRKHTGEKPYQCDFKDCERRF
SRSDQLKRHQRRHTGVKPFQCKTCQRKFSRSDHLKTHTRTHTGEKPFSCRWPSCQKKFAR
SDELVRHHNMHQRNMTKLQLAL
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
ctggacttcctcttgctgcaggacccggcttccacgtgtgtcccggagccggcgtctcag
cacacgctccgctccgggcctgggtgcctacagcagccagagcagcagggagtccgggac
ccgggcggcatctgggccaagttaggcgccgccgaggccagcgctgaacgtctccagggc
cggaggagccgcggggcgtccgggtctgagccgcagcaaatgggctccgacgtgcgggac
ctgaacgcgctgctgcccgccgtcccctccctgggtggcggcggcggctgtgccctgcct
gtgagcggcgcggcgcagtgggcgccggtgctggactttgcgcccccgggcgcttcggct
tacgggtcgttgggcggccccgcgccgccaccggctccgccgccacccccgccgccgccg
cctcactccttcatcaaacaggagccgagctggggcggcgcggagccgcacgaggagcag
tgcctgagcgccttcactgtccacttttccggccagttcactggcacagccggagcctgt
cgctacgggcccttcggtcctcctccgcccagccaggcgtcatccggccaggccaggatg
tttcctaacgcgccctacctgcccagctgcctcgagagccagcccgctattcgcaatcag
ggttacagcacggtcaccttcgacgggacgcccagctacggtcacacgccctcgcaccat
gcggcgcagttccccaaccactcattcaagcatgaggatcccatgggccagcagggctcg
ctgggtgagcagcagtactcggtgccgcccccggtctatggctgccacacccccaccgac
agctgcaccggcagccaggctttgctgctgaggacgccctacagcagtgacaatttatac
caaatgacatcccagcttgaatgcatgacctggaatcagatgaacttaggagccacctta
aagggccacagcacagggtacgagagcgataaccacacaacgcccatcctctgcggagcc
caatacagaatacacacgcacggtgtcttcagaggcattcaggatgtgcgacgtgtgcct
ggagtagccccgactcttgtacggtcggcatctgagaccagtgagaaacgccccttcatg
tgtgcttacccaggctgcaataagagatattttaagctgtcccacttacagatgcacagc
aggaagcacactggtgagaaaccataccagtgtgacttcaaggactgtgaacgaaggttt
tctcgttcagaccagctcaaaagacaccaaaggagacatacaggtgtgaaaccattccag
tgtaaaacttgtcagcgaaagttctcccggtccgaccacctgaagacccacaccaggact
catacaggtgaaaagcccttcagctgtcggtggccaagttgtcagaaaaagtttgcccgg
tcagatgaattagtccgccatcacaacatgcatcagagaaacatgaccaaactccagctg
gcgctttga

DBGET integrated database retrieval system