KEGG   Homo sapiens (human): 7494Help
Entry
7494              CDS       T01001                                 

Gene name
XBP1, TREB-5, TREB5, XBP-1, XBP2
Definition
(RefSeq) X-box binding protein 1
  KO
K09027  X box-binding protein 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04932  Non-alcoholic fatty liver disease (NAFLD)
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    7494 (XBP1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    7494 (XBP1)
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7494 (XBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7494 (XBP1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    7494 (XBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_2 bZIP_1 bZIP_Maf KASH_CCD HOOK YabA NDUF_B6
Motif
Other DBs
NCBI-GeneID: 7494
NCBI-ProteinID: NP_005071
OMIM: 194355
HGNC: 12801
Ensembl: ENSG00000100219
Vega: OTTHUMG00000151094
Pharos: P17861(Tbio)
UniProt: P17861 A0A024R1F0
Position
22q12.1; 22q12
AA seq 261 aa AA seqDB search
MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARK
RQRLTHLSPEEKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLR
EKTHGLVVENQELRQRLGMDALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQL
SPLQNISPWILAVLTLQIQSLISCWAFWTTWTQSCSSNALPQSLPAWRSSQRSTQKDPVP
YQPPFLCQWGRHQPSWKPLMN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atggtggtggtggcagccgcgccgaacccggccgacgggacccctaaagttctgcttctg
tcggggcagcccgcctccgccgccggagccccggccggccaggccctgccgctcatggtg
ccagcccagagaggggccagcccggaggcagcgagcggggggctgccccaggcgcgcaag
cgacagcgcctcacgcacctgagccccgaggagaaggcgctgaggaggaaactgaaaaac
agagtagcagctcagactgccagagatcgaaagaaggctcgaatgagtgagctggaacag
caagtggtagatttagaagaagagaaccaaaaacttttgctagaaaatcagcttttacga
gagaaaactcatggccttgtagttgagaaccaggagttaagacagcgcttggggatggat
gccctggttgctgaagaggaggcggaagccaaggggaatgaagtgaggccagtggccggg
tctgctgagtccgcagcactcagactacgtgcacctctgcagcaggtgcaggcccagttg
tcacccctccagaacatctccccatggattctggcggtattgactcttcagattcagagt
ctgatatcctgttgggcattctggacaacttggacccagtcatgttcttcaaatgccctt
ccccagagcctgccagcctggaggagctcccagaggtctacccagaaggacccagttcct
taccagcctccctttctctgtcagtggggacgtcatcagccaagctggaagccattaatg
aactaa

DBGET integrated database retrieval system