KEGG   Homo sapiens (human): 7498Help
Entry
7498              CDS       T01001                                 

Gene name
XDH, XAN1, XO, XOR
Definition
(RefSeq) xanthine dehydrogenase
  KO
K00106  xanthine dehydrogenase/oxidase [EC:1.17.1.4 1.17.3.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00230  Purine metabolism
hsa00232  Caffeine metabolism
hsa00983  Drug metabolism - other enzymes
hsa01100  Metabolic pathways
hsa04146  Peroxisome
Network
nt06025  Molybdenum cofactor biosynthesis
  Element
N00888  Hypoxanthine oxidation
N00889  XDH deficiency in hypoxanthine oxidation
Disease
H00192  Xanthinuria
Drug target
Allopurinol (DG00779): D00224 D07564
Amflutizole: D02896
Febuxostat (DG02878): D01206 D11081
Oxypurinol: D02365
Topiroxostat: D09786
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    7498 (XDH)
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    7498 (XDH)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    7498 (XDH)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    7498 (XDH)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7498 (XDH)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     7498 (XDH)
   1.17.3  With oxygen as acceptor
    1.17.3.2  xanthine oxidase
     7498 (XDH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of breast milk
   7498 (XDH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ald_Xan_dh_C2 FAD_binding_5 Ald_Xan_dh_C Fer2_2 CO_deh_flav_C Fer2 DHODB_Fe-S_bind
Motif
Other DBs
NCBI-GeneID: 7498
NCBI-ProteinID: NP_000370
OMIM: 607633
HGNC: 12805
Ensembl: ENSG00000158125
Vega: OTTHUMG00000099385
Pharos: P47989(Tclin)
UniProt: P47989
Structure
PDB: 

Position
2p23.1
AA seq 1333 aa AA seqDB search
MTADKLVFFVNGRKVVEKNADPETTLLAYLRRKLGLSGTKLGCGEGGCGACTVMLSKYDR
LQNKIVHFSANACLAPICSLHHVAVTTVEGIGSTKTRLHPVQERIAKSHGSQCGFCTPGI
VMSMYTLLRNQPEPTMEEIENAFQGNLCRCTGYRPILQGFRTFARDGGCCGGDGNNPNCC
MNQKKDHSVSLSPSLFKPEEFTPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQAS
TLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHGPDGISFG
AACPLSIVEKTLVDAVAKLPAQKTEVFRGVLEQLRWFAGKQVKSVASVGGNIITASPISD
LNPVFMASGAKLTLVSRGTRRTVQMDHTFFPGYRKTLLSPEEILLSIEIPYSREGEYFSA
FKQASRREDDIAKVTSGMRVLFKPGTTEVQELALCYGGMANRTISALKTTQRQLSKLWKE
ELLQDVCAGLAEELHLPPDAPGGMVDFRCTLTLSFFFKFYLTVLQKLGQENLEDKCGKLD
PTFASATLLFQKDPPADVQLFQEVPKGQSEEDMVGRPLPHLAADMQASGEAVYCDDIPRY
ENELSLRLVTSTRAHAKIKSIDTSEAKKVPGFVCFISADDVPGSNITGICNDETVFAKDK
VTCVGHIIGAVVADTPEHTQRAAQGVKITYEELPAIITIEDAIKNNSFYGPELKIEKGDL
KKGFSEADNVVSGEIYIGGQEHFYLETHCTIAVPKGEAGEMELFVSTQNTMKTQSFVAKM
LGVPANRIVVRVKRMGGGFGGKETRSTVVSTAVALAAYKTGRPVRCMLDRDEDMLITGGR
HPFLARYKVGFMKTGTVVALEVDHFSNVGNTQDLSQSIMERALFHMDNCYKIPNIRGTGR
LCKTNLPSNTAFRGFGGPQGMLIAECWMSEVAVTCGMPAEEVRRKNLYKEGDLTHFNQKL
EGFTLPRCWEECLASSQYHARKSEVDKFNKENCWKKRGLCIIPTKFGISFTVPFLNQAGA
LLHVYTDGSVLLTHGGTEMGQGLHTKMVQVASRALKIPTSKIYISETSTNTVPNTSPTAA
SVSADLNGQAVYAACQTILKRLEPYKKKNPSGSWEDWVTAAYMDTVSLSATGFYRTPNLG
YSFETNSGNPFHYFSYGVACSEVEIDCLTGDHKNLRTDIVMDVGSSLNPAIDIGQVEGAF
VQGLGLFTLEELHYSPEGSLHTRGPSTYKIPAFGSIPIEFRVSLLRDCPNKKAIYASKAV
GEPPLFLAASIFFAIKDAIRAARAQHTGNNVKELFRLDSPATPEKIRNACVDKFTTLCVT
GVPENCKPWSVRV
NT seq 4002 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagacaaattggttttctttgtgaatggcagaaaggtggtggagaaaaatgca
gatccagagacaacccttttggcctacctgagaagaaagttggggctgagtggaaccaag
ctcggctgtggagaggggggctgcggggcttgcacagtgatgctctccaagtatgatcgt
ctgcagaacaagatcgtccacttttctgccaatgcctgcctggcccccatctgctccttg
caccatgttgcagtgacaactgtggaaggaataggaagcaccaagacgaggctgcatcct
gtgcaggagagaattgccaaaagccacggctcccagtgcgggttctgcacccctggcatc
gtcatgagtatgtacacactgctccggaatcagcccgagcccaccatggaggagattgag
aatgccttccaaggaaatctgtgccgctgcacaggctacagacccatcctccagggcttc
cggacctttgccagggatggtggatgctgtggaggagatgggaataatccaaattgctgc
atgaaccagaagaaagaccactcagtcagcctctcgccatctttattcaaaccagaggag
ttcacgcccctggatccaacccaggagcccatttttcccccagagttgctgaggctgaaa
gacactcctcggaagcagctgcgatttgaaggggagcgtgtgacgtggatacaggcctca
accctcaaggagctgctggacctcaaggctcagcaccctgacgccaagctggtcgtgggg
aacacggagattggcattgagatgaagttcaagaatatgctgtttcctatgattgtctgc
ccagcctggatccctgagctgaattcggtagaacatggacccgacggtatctcctttgga
gctgcttgccccctgagcattgtggaaaaaaccctggtggatgctgttgctaagcttcct
gcccaaaagacagaggtgttcagaggggtcctggagcagctgcgctggtttgctgggaag
caagtcaagtctgtggcgtccgttggagggaacatcatcactgccagccccatctccgac
ctcaaccccgtgttcatggccagtggggccaagctgacacttgtgtccagaggcaccagg
agaactgtccagatggaccacaccttcttccctggctacagaaagaccctgctgagcccg
gaggagatactgctctccatagagatcccctacagcagggagggggagtatttctcagca
ttcaagcaggcctcccggagagaagatgacattgccaaggtaaccagtggcatgagagtt
ttattcaagccaggaaccacagaggtacaggagctggccctttgctatggtggaatggcc
aacagaaccatctcagccctcaagaccactcagaggcagctttccaagctctggaaggag
gagctgctgcaggacgtgtgtgcaggactggcagaggagctgcatctgcctcccgatgcc
cctggtggcatggtggacttccggtgcaccctcaccctcagcttcttcttcaagttctac
ctgacagtccttcagaagctgggccaagagaacctggaagacaagtgtggtaaactggac
cccactttcgccagtgcaactttactgtttcagaaagaccccccagccgatgtccagctc
ttccaagaggtgcccaagggtcagtctgaggaggacatggtgggccggcccctgccccac
ctggcagcggacatgcaggcctctggtgaggccgtgtactgtgacgacattcctcgctac
gagaatgagctgtctctccggctggtcaccagcacccgggcccacgccaagatcaagtcc
atagatacatcagaagctaagaaggttccagggtttgtttgtttcatttccgctgatgat
gttcctgggagtaacataactggaatttgtaatgatgagacagtctttgcgaaggataag
gttacttgtgttgggcatatcattggtgctgtggttgctgacaccccggaacacacacag
agagctgcccaaggggtgaaaatcacctatgaagaactaccagccattatcacaattgag
gatgctataaagaacaactccttttatggacctgagctgaagatcgagaaaggggaccta
aagaaggggttttccgaagcagataatgttgtgtcaggggagatatacatcggtggccaa
gagcacttctacctggagactcactgcaccattgctgttccaaaaggcgaggcaggggag
atggagctctttgtgtctacacagaacaccatgaagacccagagctttgttgcaaaaatg
ttgggggttccagcaaaccggattgtggttcgagtgaagagaatgggaggaggctttgga
ggcaaggagacccggagcactgtggtgtccacggcagtggccctggctgcatataagacc
ggccgccctgtgcgatgcatgctggaccgtgatgaggacatgctgataactggtggcaga
catcccttcctggccagatacaaggttggcttcatgaagactgggacagttgtggctctt
gaggtggaccacttcagcaatgtggggaacacccaggatctctctcagagtattatggaa
cgagctttattccacatggacaactgctataaaatccccaacatccggggcactgggcgg
ctgtgcaaaaccaaccttccctccaacacggccttccggggctttggggggccccagggg
atgctcattgccgagtgctggatgagtgaagttgcagtgacctgtgggatgcctgcagag
gaggtgcggagaaaaaacctgtacaaagaaggggacctgacacacttcaaccagaagctt
gagggtttcaccttgcccagatgctgggaagaatgcctagcaagctctcagtatcatgct
cggaagagtgaggttgacaagttcaacaaggagaattgttggaaaaagagaggattgtgc
ataattcccaccaagtttggaataagctttacagttccttttctgaatcaggcaggagcc
ctacttcatgtgtacacagatggctctgtgctgctgacccacggggggactgagatgggc
caaggccttcataccaaaatggtccaggtggccagtagagctctgaaaatccccacctct
aagatttatatcagcgagacaagcactaacactgtgcccaacacctctcccacggctgcc
tctgtcagcgctgacctcaatggacaggccgtctatgcggcttgtcagaccatcttgaaa
aggctggaaccctacaagaagaagaatcccagtggctcctgggaagactgggtcacagct
gcctacatggacacagtgagcttgtctgccactgggttttatagaacacccaatctgggc
tacagctttgagactaactcagggaaccccttccactacttcagctatggggtggcttgc
tctgaagtagaaatcgactgcctaacaggagatcataagaacctccgcacagatattgtc
atggatgttggctccagtctaaaccctgccattgatattggacaggtggaaggggcattt
gtccagggccttggcctcttcaccctagaggagctacactattcccccgaggggagcctg
cacacccgtggccctagcacctacaagatcccggcatttggcagcatccccattgagttc
agggtgtccctgctccgcgactgccccaacaagaaggccatctatgcatcgaaggctgtt
ggagagccgcccctcttcctggctgcttctatcttctttgccatcaaagatgccatccgt
gcagctcgagctcagcacacaggtaataacgtgaaggaactcttccggctagacagccct
gccaccccggagaagatccgcaatgcctgcgtggacaagttcaccaccctgtgtgtcact
ggtgtcccagaaaactgcaaaccctggtctgtgagggtctaa

DBGET integrated database retrieval system