KEGG   Homo sapiens (human): 7507
Entry
7507              CDS       T01001                                 
Symbol
XPA, XP1, XPAC
Name
(RefSeq) XPA, DNA damage recognition and repair factor
  KO
K10847  DNA-repair protein complementing XP-A cells
Organism
hsa  Homo sapiens (human)
Pathway
hsa01524  Platinum drug resistance
hsa03420  Nucleotide excision repair
Network
  Element
N01431  Core NER reaction
Disease
H00403  Disorders of nucleotide excision repair
H01428  Xeroderma pigmentosum
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03420 Nucleotide excision repair
    7507 (XPA)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    7507 (XPA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7507 (XPA)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    Other NER factors
     7507 (XPA)
SSDB
Motif
Pfam: XPA_C XPA_N Zn-ribbon_8 zf_C2H2_13
Other DBs
NCBI-GeneID: 7507
NCBI-ProteinID: NP_000371
OMIM: 611153
HGNC: 12814
Ensembl: ENSG00000136936
Pharos: P23025(Tbio)
UniProt: P23025
Structure
Position
9:complement(97654398..97697340)
AA seq 273 aa
MAAADGALPEAAALEQPAELPASVRASIERKRQRALMLRQARLAARPYSATAAAATGGMA
NVKAAPKIIDTGGGFILEEEEEEEQKIGKVVHQPGPVMEFDYVICEECGKEFMDSYLMNH
FDLPTCDNCRDADDKHKLITKTEAKQEYLLKDCDLEKREPPLKFIVKKNPHHSQWGDMKL
YLKLQIVKRSLEVWGSQEALEEAKEVRQENREKMKQKKFDKKVKELRRAVRSSVWKRETI
VHQHEYGPEENLEDDMYRKTCTMCGHELTYEKM
NT seq 822 nt   +upstreamnt  +downstreamnt
atggcggcggccgacggggctttgccggaggcggcggctttagagcaacccgcggagctg
cctgcctcggtgcgggcgagtatcgagcggaagcggcagcgggcactgatgctgcgccag
gcccggctggctgcccggccctactcggcgacggcggctgcggctactggaggcatggct
aatgtaaaagcagccccaaagataattgacacaggaggaggcttcattttagaagaggaa
gaagaagaagaacagaaaattggaaaagttgttcatcaaccaggacctgttatggaattt
gattatgtaatatgcgaagaatgtgggaaagaatttatggattcttatcttatgaaccac
tttgatttgccaacttgtgataactgcagagatgctgatgataaacacaagcttataacc
aaaacagaggcaaaacaagaatatcttctgaaagactgtgatttagaaaaaagagagcca
cctcttaaatttattgtgaagaagaatccacatcattcacaatggggtgatatgaaactc
tacttaaagttacagattgtgaagaggtctcttgaagtttggggtagtcaagaagcatta
gaagaagcaaaggaagtccgacaggaaaaccgagaaaaaatgaaacagaagaaatttgat
aaaaaagtaaaagaattgcggcgagcagtaagaagcagcgtgtggaaaagggagacgatt
gttcatcaacatgagtatggaccagaagaaaacctagaagatgacatgtaccgtaagact
tgtactatgtgtggccatgaactgacatatgaaaaaatgtga

DBGET integrated database retrieval system