KEGG   Homo sapiens (human): 7511Help
Entry
7511              CDS       T01001                                 

Gene name
XPNPEP1, APP1, SAMP, XPNPEP, XPNPEPL, XPNPEPL1
Definition
(RefSeq) X-prolyl aminopeptidase 1
  KO
K01262  Xaa-Pro aminopeptidase [EC:3.4.11.9]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    7511 (XPNPEP1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.9  Xaa-Pro aminopeptidase
     7511 (XPNPEP1)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M24
   7511 (XPNPEP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M24 Creatinase_N_2 Peptidase_M24_C Creatinase_N
Motif
Other DBs
NCBI-GeneID: 7511
NCBI-ProteinID: NP_001311061
OMIM: 602443
HGNC: 12822
Ensembl: ENSG00000108039
Vega: OTTHUMG00000019029
Pharos: Q9NQW7(Tbio)
UniProt: Q9NQW7
Structure
PDB: 

Position
10q25.1
AA seq 623 aa AA seqDB search
MPPKVTSELLRQLRQAMRNSEYVTEPIQAYIIPSGDAHQSEYIAPCDCRRAFVSGFDGSA
GTAIITEEHAAMWTDGRYFLQAAKQMDSNWTLMKMGLKDTPTQEDWLVSVLPEGSRVGVD
PLIIPTDYWKKMAKVLRSAGHHLIPVKENLVDKIWTDRPERPCKPLLTLGLDYTGISWKD
KVADLRLKMAERNVMWFVVTALDEIAWLFNLRGSDVEHNPVFFSYAIIGLETIMLFIDGD
RIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSE
TIPKDHRCCMPYTPICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEI
SAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETNRTLSLDEVYLIDSGAQY
KDGTTDVTRTMHFGTPTAYEKECFTYVLKGHIAVSAAVFPTGTKGHLLDSFARSALWDSG
LDYLHGTGHGVGSFLNVHEGPCGISYKTFSDEPLEAGMIVTDEPGYYEDGAFGIRIENVV
LVVPVKTKYNFNNRGSLTFEPLTLVPIQTKMIDVDSLTDKECDWLNNYHLTCRDVIGKEL
QKQGRQEALEWLIRETQPISKQH
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgcctccaaaggtgacttcagagctgcttcggcagctgagacaagccatgaggaactct
gagtatgtgaccgaaccgatccaggcctacatcatcccatcgggagatgctcatcagagt
gagtatattgctccatgtgactgtcggcgggcttttgtctctggattcgatggctctgcg
ggcacagccatcatcacagaagagcatgcagccatgtggactgacgggcgctactttctc
caggctgccaagcaaatggacagcaactggacacttatgaagatgggtctgaaggacaca
ccaactcaggaagactggctggtgagtgtgcttcctgaaggatccagggttggtgtggac
cccttgatcattcctacagattattggaagaaaatggccaaagttctgagaagtgccggc
catcacctcattcctgtcaaggagaacctcgttgacaaaatctggacagaccgtcctgag
cgcccttgcaagcctctcctcacactgggcctggattacacaggcatctcctggaaggac
aaggttgcagaccttcggttgaaaatggctgagaggaacgtcatgtggtttgtggtcact
gccttggatgagattgcgtggctatttaatctccgaggatcagatgtggagcacaatcca
gtatttttctcctacgcaatcataggactagagacgatcatgctcttcattgatggtgac
cgcatagacgcccccagtgtgaaggagcacctgcttcttgacttgggtctggaagccgaa
tacaggatccaggtgcatccctacaagtccatcctgagcgagctcaaggccctgtgtgct
gacctctccccaagggagaaggtgtgggtcagtgacaaggccagctatgctgtgagcgag
accatccccaaggaccaccgctgctgtatgccttacacccccatctgcatcgccaaagct
gtgaagaattcagctgagtcagaaggcatgaggcgggctcacattaaagatgctgttgct
ctctgtgaactctttaactggctggagaaagaggttcccaaaggtggtgtgacagagatc
tcagctgctgacaaagctgaggagtttcgcaggcaacaggcagactttgtggacctgagc
ttcccaacaatttccagtacgggacccaacggcgccatcattcactacgcgccagtccct
gagacgaataggaccttgtccctggatgaggtgtaccttattgactcgggtgctcaatac
aaggatggcaccacagatgtgacgcggacaatgcattttgggacccctacagcctacgag
aaggaatgcttcacatatgtcctcaagggccacatagctgtgagtgcagccgttttcccg
actggaaccaaaggtcaccttcttgactcctttgcccgttcagctttatgggattcaggc
ctagattacttgcacgggactggacatggtgttgggtcttttttgaatgtccatgagggt
ccttgcggcatcagttacaaaacattctctgatgagcccttggaggcaggcatgattgtc
actgatgagcccgggtactatgaagatggggcttttggaattcgcattgagaatgttgtc
cttgtggttcctgtgaagaccaagtataattttaataaccggggaagcctgacctttgaa
cctctaacattggttccaattcagaccaaaatgatagatgtggattctcttacagacaaa
gagtgcgactggctcaacaattaccacctgacctgcagggatgtgattgggaaggaattg
cagaaacagggccgccaggaagctctcgagtggctcatcagagagacgcaacccatctcc
aaacagcattaa

DBGET integrated database retrieval system