KEGG   Homo sapiens (human): 7514Help
Entry
7514              CDS       T01001                                 

Gene name
XPO1, CRM1, emb, exp1
Definition
(RefSeq) exportin 1
  KO
K14290  exportin-1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03008  Ribosome biogenesis in eukaryotes
hsa03013  RNA transport
hsa05164  Influenza A
hsa05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    7514 (XPO1)
   03008 Ribosome biogenesis in eukaryotes
    7514 (XPO1)
 09160 Human Diseases
  09172 Infectious diseases: Viral
   05166 Human T-cell leukemia virus 1 infection
    7514 (XPO1)
   05164 Influenza A
    7514 (XPO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:hsa03019]
    7514 (XPO1)
   03009 Ribosome biogenesis [BR:hsa03009]
    7514 (XPO1)
   03016 Transfer RNA biogenesis [BR:hsa03016]
    7514 (XPO1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    7514 (XPO1)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     7514 (XPO1)
Ribosome biogenesis [BR:hsa03009]
 Eukaryotic Type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    7514 (XPO1)
  Pre-60S particles
    7514 (XPO1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic Type
  tRNA transport factors
   tRNA export factors
    7514 (XPO1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     7514 (XPO1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CRM1_C Xpo1 CRM1_repeat_2 CRM1_repeat_3 CRM1_repeat IBN_N Hydrolase_3
Motif
Other DBs
NCBI-GeneID: 7514
NCBI-ProteinID: NP_003391
OMIM: 602559
HGNC: 12825
Ensembl: ENSG00000082898
Vega: OTTHUMG00000152316
Pharos: O14980(Tbio)
UniProt: O14980 B3KWD0
Structure
PDB: 

Position
2p15
AA seq 1071 aa AA seqDB search
MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTL
LQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
SLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD
NT seq 3216 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgcttgatttcagc
caaaaactggatatcaacttattagataatgtggtgaattgcttataccatggagaagga
gcccagcaaagaatggctcaagaagtactgacacatttaaaggagcatcctgatgcttgg
acaagagtcgacacaattttggaattttctcagaatatgaatacgaaatactatggacta
caaattttggaaaatgtgataaaaacaaggtggaagattcttccaaggaaccagtgcgaa
ggaataaaaaaatacgttgttggcctcattatcaagacgtcatctgacccaacttgtgta
gagaaagaaaaggtgtatatcggaaaattaaatatgatccttgttcagatactgaaacaa
gaatggcccaaacattggccaacttttatcagtgatattgttggagcaagtaggaccagc
gaaagtctctgtcaaaataatatggtgattcttaaactcttgagtgaagaagtatttgat
ttctctagtggacagataacccaagtcaaatctaagcatttaaaagacagcatgtgcaat
gaattctcacagatatttcaactgtgtcagtttgtaatggaaaattctcaaaatgctcca
cttgtacatgcaaccttggaaacattgctcagatttctgaactggattcccctgggatat
atttttgagaccaaattaatcagcacattgatttataagttcctgaatgttccaatgttt
cgaaatgtctctctgaagtgcctcactgagattgctggtgtgagtgtaagccaatatgaa
gaacaatttgtaacactatttactctgacaatgatgcaactaaagcagatgcttccttta
aataccaatattcgacttgcgtactcaaatggaaaagatgatgaacagaacttcattcaa
aatctcagtttgtttctctgcacctttcttaaggaacatgatcaacttatagaaaaaaga
ttaaatctcagggaaactcttatggaggcccttcattatatgttgttggtatctgaagta
gaagaaactgaaatctttaaaatttgtcttgaatactggaatcatttggctgctgaactc
tatagagagagtccattctctacatctgcctctccgttgctttctggaagtcaacatttt
gatgttcctcccaggagacagctatatttgcccatgttattcaaggtccgtttattaatg
gttagtcgaatggctaaaccagaggaagtattggttgtagagaatgatcaaggagaagtt
gtgagagaattcatgaaggatacagattccataaatttgtataagaatatgagggaaaca
ttggtttatcttactcatctggattatgtagatacagaaagaataatgacagagaagctt
cacaatcaagtgaatggtacagagtggtcatggaaaaatttgaatacattgtgttgggca
ataggctccattagtggagcaatgcatgaagaggacgaaaaacgatttcttgttactgtt
ataaaggatctattaggattatgtgaacagaaaagaggcaaagataataaagctattatt
gcatcaaatatcatgtacatagtaggtcaatacccacgttttttgagagctcactggaaa
tttctgaagactgtagttaacaagctgttcgaattcatgcatgagacccatgatggagtc
caggatatggcttgtgatactttcattaaaatagcccaaaaatgccgcaggcatttcgtt
caggttcaggttggagaagtgatgccatttattgatgaaattttgaacaacattaacact
attatttgtgatcttcagcctcaacaggttcatacgttttatgaagctgtggggtacatg
attggtgcacaaacagatcaaacagtacaagaacacttgatagaaaagtacatgttactc
cctaatcaagtgtgggatagtataatccagcaggcaaccaaaaatgtggatatactgaaa
gatcctgaaacagtcaagcagcttggtagcattttgaaaacaaatgtgagagcctgcaaa
gctgttggacacccctttgtaattcagcttggaagaatttatttagatatgcttaatgta
tacaagtgcctcagtgaaaatatttctgcagctatccaagctaatggtgaaatggttaca
aagcaaccattgattagaagtatgcgaactgtaaaaagggaaactttaaagttaatatct
ggttgggtgagccgatccaatgatccacagatggtcgctgaaaattttgttccccctctg
ttggatgcagttctcattgattatcagagaaatgtcccagctgctagagaaccagaagtg
cttagtactatggccataattgtcaacaagttagggggacatataacagctgaaatacct
caaatatttgatgctgtttttgaatgcacattgaatatgataaataaggactttgaagaa
tatcctgaacatagaacgaactttttcttactacttcaggctgtcaattctcattgtttc
ccagcattccttgctattccacctacacagtttaaacttgttttggattccatcatttgg
gctttcaaacatactatgaggaatgtcgcagatacgggcttacagatactttttacactc
ttacaaaatgttgcacaagaagaagctgcagctcagagtttttatcaaacttatttttgt
gatattctccagcatatcttttctgttgtgacagacacttcacatactgctggtttaaca
atgcatgcatcaattcttgcatatatgtttaatttggttgaagaaggaaaaataagtaca
tcattaaatcctggaaatccagttaacaaccaaatctttcttcaggaatatgtggctaat
ctccttaagtcggccttccctcacctacaagatgctcaagtaaagctctttgtgacaggg
cttttcagcttaaatcaagatattcctgctttcaaggaacatttaagagatttcctagtt
caaataaaggaatttgcaggtgaagacacttctgatttgtttttggaagagagagaaata
gccctacggcaggctgatgaagagaaacataaacgtcaaatgtctgtccctggcatcttt
aatccacatgagattccagaagaaatgtgtgattaa

DBGET integrated database retrieval system