KEGG   Homo sapiens (human): 752Help
Entry
752               CDS       T01001                                 

Gene name
FMNL1, C17orf1, C17orf1B, FHOD4, FMNL, KW-13
Definition
(RefSeq) formin like 1
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: FH2 Drf_FH3 Drf_GBD CLTH LXG DUF1825 ZapD Atg14 Mis12 DUF4201 Ead_Ea22 I_LWEQ FlgN Phage_GPO
Motif
Other DBs
NCBI-GeneID: 752
NCBI-ProteinID: NP_005883
OMIM: 604656
HGNC: 1212
Ensembl: ENSG00000184922
Vega: OTTHUMG00000180196
Pharos: O95466(Tbio)
UniProt: O95466
Structure
PDB: 

Position
17q21.31
AA seq 1100 aa AA seqDB search
MGNAAGSAEQPAGPAAPPPKQPAPPKQPMPAAGELEERFNRALNCMNLPPDKVQLLSQYD
NEKKWELICDQERFQVKNPPAAYIQKLKSYVDTGGVSRKVAADWMSNLGFKRRVQESTQV
LRELETSLRTNHIGWVQEFLNEENRGLDVLLEYLAFAQCSVTYDMESTDNGASNSEKNKP
LEQSVEDLSKGPPSSVPKSRHLTIKLTPAHSRKALRNSRIVSQKDDVHVCIMCLRAIMNY
QSGFSLVMNHPACVNEIALSLNNKNPRTKALVLELLAAVCLVRGGHDIILAAFDNFKEVC
GEQHRFEKLMEYFRNEDSNIDFMVACMQFINIVVHSVENMNFRVFLQYEFTHLGLDLYLE
RLRLTESDKLQVQIQAYLDNIFDVGALLEDTETKNAVLEHMEELQEQVALLTERLRDAEN
ESMAKIAELEKQLSQARKELETLRERFSESTAMGPSRRPPEPEKAPPAAPTRPSALELKV
EELEEKGLIRILRGPGDAVSIEILPVAVATPSGGDAPTPGVPTGSPSPDLAPAAEPAPGA
APPPPPPLPGLPSPQEAPPSAPPQAPPLPGSPEPPPAPPLPGDLPPPPPPPPPPPGTDGP
VPPPPPPPPPPPGGPPDALGRRDSELGPGVKAKKPIQTKFRMPLLNWVALKPSQITGTVF
TELNDEKVLQELDMSDFEEQFKTKSQGPSLDLSALKSKAAQKAPSKATLIEANRAKNLAI
TLRKGNLGAERICQAIEAYDLQALGLDFLELLMRFLPTEYERSLITRFEREQRPMEELSE
EDRFMLCFSRIPRLPERMTTLTFLGNFPDTAQLLMPQLNAIIAASMSIKSSDKLRQILEI
VLAFGNYMNSSKRGAAYGFRLQSLDALLEMKSTDRKQTLLHYLVKVIAEKYPQLTGFHSD
LHFLDKAGSVSLDSVLADVRSLQRGLELTQREFVRQDDCMVLKEFLRANSPTMDKLLADS
KTAQEAFESVVEYFGENPKTTSPGLFFSLFSRFIKAYKKAEQEVEQWKKEAAAQEAGADT
PGKGEPPAPKSPPKARRPQMDLISELKRRQQKEPLIYESDRDGAIEDIITVIKTVPFTAR
TGKRTSRLLCEASLGEEMPL
NT seq 3303 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgcggccggcagcgccgagcagcccgcgggccccgccgcgccgccccccaag
cagcccgcgcctcccaagcagccgatgcccgcggccggagagctggaggagaggttcaac
cgcgccctgaactgcatgaacttgcccccagacaaggtccagctgctgagccagtatgac
aacgagaagaagtgggagctcatctgtgatcaggagcggtttcaagtcaagaatcccccc
gcagcctacatccagaagctgaagagctatgtggatactggtggggtcagccgaaaggta
gcagctgattggatgtccaacctggggtttaagaggcgagttcaggagtccacgcaggtg
ctacgggagctggagacctccctgaggaccaaccacattgggtgggtgcaggagttcctc
aatgaagagaaccgtggcctggatgtgctgctcgagtacctggcctttgcccagtgctct
gtcacgtatgacatggagagcacagacaacggggcttccaactcagagaaaaacaagccc
ctggagcagtctgtggaagacctcagcaagggtccaccctcctccgtgcccaaaagccgc
cacctgaccatcaagctgaccccagcccacagcaggaaggccctgcggaattcccgcatc
gtcagccagaaggacgacgtccacgtctgtattatgtgcctacgcgccatcatgaactac
cagtctggcttcagccttgtcatgaaccacccagcctgtgtcaatgagattgctctgagc
ctcaacaacaagaaccccagaaccaaggctctggtgctggagctgctggcggccgtgtgc
ttggtgcggggaggacatgacatcatccttgcagcctttgacaacttcaaggaggtgtgt
ggggagcagcaccgctttgaaaagctgatggaatatttccggaatgaggacagcaacatc
gacttcatggtggcctgcatgcagttcatcaacattgtggtacattcggtggagaacatg
aacttccgtgtcttcctgcaatatgagttcacccacttgggcctggacctgtacttggag
aggcttcggctcaccgagagtgacaagctgcaggtgcagatccaggcgtacctggacaat
atttttgatgtgggggcgctgctggaggacacagagaccaagaacgctgtgctggagcac
atggaggaactgcaggagcaagtggcgctgctgacagagcggcttcgggacgcggagaac
gaatccatggccaagattgcagaactggaaaaacagctaagccaggcgcgcaaggagttg
gagaccctgcgggagcgcttcagcgaatcgaccgccatggggccctccaggcgtccccca
gagcctgagaaagcgcctcccgctgccccgacgcggccctcggccctggagctgaaggtg
gaggagctggaggagaaggggttaatccgtattctgcgggggccgggggatgctgtctcc
atcgagatcctccccgtcgctgtggcaactccgagcggcggtgatgctccgactccgggg
gtgccgaccggctcccccagcccagatctcgcacctgcagcagagccggctcccggagca
gcgccaccgccgccgcccccactgcccggcctcccctccccgcaggaagccccgccctct
gcgcccccacaggccccgcctctccctggcagcccggagcccccgcctgcgccgccgctg
cccggagacctgccgcccccacccccgccaccgccaccacctccgggcactgacgggccg
gtgcctccgccgccgccgccgccgccgccgcctcccggaggtcctcctgatgccctagga
agacgcgactcagaattgggcccaggagtgaaggccaagaagcccatccagactaagttc
cgaatgccactcttgaactgggtggcactgaaacccagccagatcaccggcactgtcttc
acagagctcaatgatgagaaggtgctgcaggagctagacatgagtgattttgaggaacag
ttcaagaccaagtcccaaggccccagcctggacctcagcgctctcaagagtaaggcagcc
cagaaggcccccagcaaggcgacactcattgaggccaaccgggccaagaacttggccatc
accctgcggaagggcaacctgggggccgagcgcatctgccaagccattgaggcgtacgac
ctgcaggctctgggcctggacttcctggagctgctgatgcgcttcctgcccacagagtat
gagcgcagcctcatcacccgctttgagcgggagcagcggccaatggaggagctgtcagag
gaggaccgcttcatgctatgcttcagccgcatcccgcgcctgccggagcgcatgaccaca
ctcaccttcctgggcaacttcccggacacagcccagctgctcatgccgcaactgaatgcc
atcattgcagcctcaatgtccatcaagtcctctgacaaactccgccagatcctggagatt
gtcctggcctttggcaactacatgaacagtagcaagcgtggggcagcctatggcttccgg
ctccagagcctggatgcgctgttggagatgaagtcgactgatcgcaagcagacgctgctg
cactacctggtgaaggtcattgctgagaagtacccgcaactcacaggcttccacagcgac
ctgcacttcctggacaaggcgggctcagtgtccctggacagtgtcctggcggacgtgcgc
tccctgcagcgaggcctagagttgacacagagagagtttgtgcggcaggatgactgcatg
gtgctcaaggagttcctgagggccaactcgcccaccatggacaagctgctggcagacagc
aagacggctcaggaggcctttgagtctgtggtggagtacttcggagagaaccccaagacc
acatccccaggcctgttcttctccctctttagccgcttcattaaggcctacaagaaagct
gagcaggaggtggaacagtggaaaaaagaagccgctgcccaggaggcaggcgctgatacc
ccgggcaaaggggagcccccagcacccaagtcaccgccaaaggcccggcggccacagatg
gacctcatctctgagctgaaacggaggcagcagaaggagccactcatttatgagagcgac
cgtgatggggccattgaagacatcatcacagtgatcaagacggtgcccttcacggcccgc
accggcaagcggacatcccggctcctctgtgaggccagcctgggagaagagatgcccctc
tag

DBGET integrated database retrieval system