KEGG   Homo sapiens (human): 7520Help
Entry
7520              CDS       T01001                                 

Gene name
XRCC5, KARP-1, KARP1, KU80, KUB2, Ku86, NFIV
Definition
(RefSeq) X-ray repair cross complementing 5
  KO
K10885  ATP-dependent DNA helicase 2 subunit 2
Organism
hsa  Homo sapiens (human)
Pathway
hsa03450  Non-homologous end-joining
Module
hsa_M00297  DNA-PK complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    7520 (XRCC5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7520 (XRCC5)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    DNA-PK complex
     7520 (XRCC5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ku_N Ku Ku_PK_bind Ku_C Beta-TrCP_D
Motif
Other DBs
NCBI-GeneID: 7520
NCBI-ProteinID: NP_066964
OMIM: 194364
HGNC: 12833
Ensembl: ENSG00000079246
Vega: OTTHUMG00000133059
Pharos: P13010(Tbio)
UniProt: P13010
Structure
PDB: 

Position
2q35
AA seq 732 aa AA seqDB search
MVRSGNKAAVVLCMDVGFTMSNSIPGIESPFEQAKKVITMFVQRQVFAENKDEIALVLFG
TDGTDNPLSGGDQYQNITVHRHLMLPDFDLLEDIESKIQPGSQQADFLDALIVSMDVIQH
ETIGKKFEKRHIEIFTDLSSRFSKSQLDIIIHSLKKCDISLQFFLPFSLGKEDGSGDRGD
GPFRLGGHGPSFPLKGITEQQKEGLEIVKMVMISLEGEDGLDEIYSFSESLRKLCVFKKI
ERHSIHWPCRLTIGSNLSIRIAAYKSILQERVKKTWTVVDAKTLKKEDIQKETVYCLNDD
DETEVLKEDIIQGFRYGSDIVPFSKVDEEQMKYKSEGKCFSVLGFCKSSQVQRRFFMGNQ
VLKVFAARDDEAAAVALSSLIHALDDLDMVAIVRYAYDKRANPQVGVAFPHIKHNYECLV
YVQLPFMEDLRQYMFSSLKNSKKYAPTEAQLNAVDALIDSMSLAKKDEKTDTLEDLFPTT
KIPNPRFQRLFQCLLHRALHPREPLPPIQQHIWNMLNPPAEVTTKSQIPLSKIKTLFPLI
EAKKKDQVTAQEIFQDNHEDGPTAKKLKTEQGGAHFSVSSLAEGSVTSVGSVNPAENFRV
LVKQKKASFEEASNQLINHIEQFLDTNETPYFMKSIDCIRAFREEAIKFSEEQRFNNFLK
ALQEKVEIKQLNHFWEIVVQDGITLITKEEASGSSVTAEEAKKFLAPKDKPSGDTAAVFE
EGGDVDDLLDMI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggtgcggtcggggaataaggcagctgttgtgctgtgtatggacgtgggctttaccatg
agtaactccattcctggtatagaatccccatttgaacaagcaaagaaggtgataaccatg
tttgtacagcgacaggtgtttgctgagaacaaggatgagattgctttagtcctgtttggt
acagatggcactgacaatcccctttctggtggggatcagtatcagaacatcacagtgcac
agacatctgatgctaccagattttgatttgctggaggacattgaaagcaaaatccaacca
ggttctcaacaggctgacttcctggatgcactaatcgtgagcatggatgtgattcaacat
gaaacaataggaaagaagtttgagaagaggcatattgaaatattcactgacctcagcagc
cgattcagcaaaagtcagctggatattataattcatagcttgaagaaatgtgacatctcc
ctgcaattcttcttgcctttctcacttggcaaggaagatggaagtggggacagaggagat
ggcccctttcgcttaggtggccatgggccttcctttccactaaaaggaattaccgaacag
caaaaagaaggtcttgagatagtgaaaatggtgatgatatctttagaaggtgaagatggg
ttggatgaaatttattcattcagtgagagtctgagaaaactgtgcgtcttcaagaaaatt
gagaggcattccattcactggccctgccgactgaccattggctccaatttgtctataagg
attgcagcctataaatcgattctacaggagagagttaaaaagacttggacagttgtggat
gcaaaaaccctaaaaaaagaagatatacaaaaagaaacagtttattgcttaaatgatgat
gatgaaactgaagttttaaaagaggatattattcaagggttccgctatggaagtgatata
gttcctttctctaaagtggatgaggaacaaatgaaatataaatcggaggggaagtgcttc
tctgttttgggattttgtaaatcttctcaggttcagagaagattcttcatgggaaatcaa
gttctaaaggtctttgcagcaagagatgatgaggcagctgcagttgcactttcctccctg
attcatgctttggatgacttagacatggtggccatagttcgatatgcttatgacaaaaga
gctaatcctcaagtcggcgtggcttttcctcatatcaagcataactatgagtgtttagtg
tatgtgcagctgcctttcatggaagacttgcggcaatacatgttttcatccttgaaaaac
agtaagaaatatgctcccaccgaggcacagttgaatgctgttgatgctttgattgactcc
atgagcttggcaaagaaagatgagaagacagacacccttgaagacttgtttccaaccacc
aaaatcccaaatcctcgatttcagagattatttcagtgtctgctgcacagagctttacat
ccccgggagcctctacccccaattcagcagcatatttggaatatgctgaatcctcccgct
gaggtgacaacaaaaagtcagattcctctctctaaaataaagaccctttttcctctgatt
gaagccaagaaaaaggatcaagtgactgctcaggaaattttccaagacaaccatgaagat
ggacctacagctaaaaaattaaagactgagcaagggggagcccacttcagcgtctccagt
ctggctgaaggcagtgtcacctctgttggaagtgtgaatcctgctgaaaacttccgtgtt
ctagtgaaacagaagaaggccagctttgaggaagcgagtaaccagctcataaatcacatc
gaacagtttttggatactaatgaaacaccgtattttatgaagagcatagactgcatccga
gccttccgggaagaagccattaagttttcagaagagcagcgctttaacaacttcctgaaa
gcccttcaagagaaagtggaaattaaacaattaaatcatttctgggaaattgttgtccag
gatggaattactctgatcaccaaagaggaagcctctggaagttctgtcacagctgaggaa
gccaaaaagtttctggcccccaaagacaaaccaagtggagacacagcagctgtatttgaa
gaaggtggtgatgtggacgatttattggacatgatatag

DBGET integrated database retrieval system