KEGG   Homo sapiens (human): 7525Help
Entry
7525              CDS       T01001                                 

Gene name
YES1, HsT441, P61-YES, Yes, c-yes
Definition
(RefSeq) YES proto-oncogene 1, Src family tyrosine kinase
  KO
K05705  tyrosine-protein kinase Yes [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04520  Adherens junction
Drug target
Dasatinib (DG00714): D03658 D06414
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    7525 (YES1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7525 (YES1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    7525 (YES1)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7525 (YES1)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SRC family
   7525 (YES1)
Membrane trafficking [BR:hsa04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    7525 (YES1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase SH3_10 zf-RING_14 SH3_3 YdjC hSH3
Motif
Other DBs
NCBI-GeneID: 7525
NCBI-ProteinID: NP_005424
OMIM: 164880
HGNC: 12841
Ensembl: ENSG00000176105
Vega: OTTHUMG00000131472
Pharos: P07947(Tclin)
UniProt: P07947
Structure
PDB: 

Position
18p11.32
AA seq 543 aa AA seqDB search
MGCIKSKENKSPAIKYRPENTPEPVSTSVSHYGAEPTTVSPCPSSSAKGTAVNFSSLSMT
PFGGSSGVTPFGGASSSFSVVPSSYPAGLTGGVTIFVALYDYEARTTEDLSFKKGERFQI
INNTEGDWWEARSIATGKNGYIPSNYVAPADSIQAEEWYFGKMGRKDAERLLLNPGNQRG
IFLVRESETTKGAYSLSIRDWDEIRGDNVKHYKIRKLDNGGYYITTRAQFDTLQKLVKHY
TEHADGLCHKLTTVCPTVKPQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTT
KVAIKTLKPGTMMPEAFLQEAQIMKKLRHDKLVPLYAVVSEEPIYIVTEFMSKGSLLDFL
KEGDGKYLKLPQLVDMAAQIADGMAYIERMNYIHRDLRAANILVGENLVCKIADFGLARL
IEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILQTELVTKGRVPYPGMVNRE
VLEQVERGYRMPCPQGCPESLHELMNLCWKKDPDERPTFEYIQSFLEDYFTATEPQYQPG
ENL
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atgggctgcattaaaagtaaagaaaacaaaagtccagccattaaatacagacctgaaaat
actccagagcctgtcagtacaagtgtgagccattatggagcagaacccactacagtgtca
ccatgtccgtcatcttcagcaaagggaacagcagttaatttcagcagtctttccatgaca
ccatttggaggatcctcaggggtaacgccttttggaggtgcatcttcctcattttcagtg
gtgccaagttcatatcctgctggtttaacaggtggtgttactatatttgtggccttatat
gattatgaagctagaactacagaagacctttcatttaagaagggtgaaagatttcaaata
attaacaatacggaaggagattggtgggaagcaagatcaatcgctacaggaaagaatggt
tatatcccgagcaattatgtagcgcctgcagattccattcaggcagaagaatggtatttt
ggcaaaatggggagaaaagatgctgaaagattacttttgaatcctggaaatcaacgaggt
attttcttagtaagagagagtgaaacaactaaaggtgcttattccctttctattcgtgat
tgggatgagataaggggtgacaatgtgaaacactacaaaattaggaaacttgacaatggt
ggatactatatcacaaccagagcacaatttgatactctgcagaaattggtgaaacactac
acagaacatgctgatggtttatgccacaagttgacaactgtgtgtccaactgtgaaacct
cagactcaaggtctagcaaaagatgcttgggaaatccctcgagaatctttgcgactagag
gttaaactaggacaaggatgtttcggcgaagtgtggatgggaacatggaatggaaccacg
aaagtagcaatcaaaacactaaaaccaggtacaatgatgccagaagctttccttcaagaa
gctcagataatgaaaaaattaagacatgataaacttgttccactatatgctgttgtttct
gaagaaccaatttacattgtcactgaatttatgtcaaaaggaagcttattagatttcctt
aaggaaggagatggaaagtatttgaagcttccacagctggttgatatggctgctcagatt
gctgatggtatggcatatattgaaagaatgaactatattcaccgagatcttcgggctgct
aatattcttgtaggagaaaatcttgtgtgcaaaatagcagactttggtttagcaaggtta
attgaagacaatgaatacacagcaagacaaggtgcaaaatttccaatcaaatggacagct
cctgaagctgcactgtatggtcggtttacaataaagtctgatgtctggtcatttggaatt
ctgcaaacagaactagtaacaaagggccgagtgccatatccaggtatggtgaaccgtgaa
gtattagaacaagtggagcgaggatacaggatgccgtgccctcagggctgtccagaatcc
ctccatgaattgatgaatctgtgttggaagaaggaccctgatgaaagaccaacatttgaa
tatattcagtccttcttggaagactacttcactgctacagagccacagtaccagccagga
gaaaatttataa

DBGET integrated database retrieval system