KEGG   Homo sapiens (human): 7528Help
Entry
7528              CDS       T01001                                 

Gene name
YY1, DELTA, GADEVS, INO80S, NF-E1, UCRBP, YIN-YANG-1
Definition
(RefSeq) YY1 transcription factor
  KO
K09201  transcription factor YY
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7528 (YY1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    7528 (YY1)
   03029 Mitochondrial biogenesis [BR:hsa03029]
    7528 (YY1)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 ubiquitous factors
    7528 (YY1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Polycomb group proteins
    Other polycomb group proteins
     7528 (YY1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Ubiquitas transcription factors
    7528 (YY1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2 zf-H2C2_2 zf-C2H2_4 Raffinose_syn IBR GRP
Motif
Other DBs
NCBI-GeneID: 7528
NCBI-ProteinID: NP_003394
OMIM: 600013
HGNC: 12856
Ensembl: ENSG00000100811
Vega: OTTHUMG00000150479
Pharos: P25490(Tbio)
UniProt: P25490
Structure
PDB: 

Position
14q32.2
AA seq 414 aa AA seqDB search
MASGDTLYIATDGSEMPAEIVELHEIEVETIPVETIETTVVGEEEEEDDDDEDGGGGDHG
GGGGHGHAGHHHHHHHHHHHPPMIALQPLVTDDPTQVHHHQEVILVQTREEVVGGDDSDG
LRAEDGFEDQILIPVPAPAGGDDDYIEQTLVTVAAAGKSGGGGSSSSGGGRVKKGGGKKS
GKKSYLSGGAGAAGGGGADPGNKKWEQKQVQIKTLEGEFSVTMWSSDEKKDIDHETVVEE
QIIGENSPPDYSEYMTGKKLPPGGIPGIDLSDPKQLAEFARMKPRKIKEDDAPRTIACPH
KGCTKMFRDNSAMRKHLHTHGPRVHVCAECGKAFVESSKLKRHQLVHTGEKPFQCTFEGC
GKRFSLDFNLRTHVRIHTGDRPYVCPFDGCNKKFAQSTNLKSHILTHAKAKNNQ
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atggcctcgggcgacaccctctacatcgccacggacggctcggagatgccggccgagatc
gtggagctgcacgagatcgaggtggagaccatcccggtggagaccatcgagaccacagtg
gtgggcgaggaggaggaggaggacgacgacgacgaggacggcggcggtggcgaccacggc
ggcgggggcggccacgggcacgccggccaccaccaccaccaccatcaccaccaccaccac
ccgcccatgatcgctctgcagccgctggtcaccgacgacccgacccaggtgcaccaccac
caggaggtgatcctggtgcagacgcgcgaggaggtggtgggcggcgacgactcggacggg
ctgcgcgccgaggacggcttcgaggatcagattctcatcccggtgcccgcgccggccggc
ggcgacgacgactacattgaacaaacgctggtcaccgtggcggcggccggcaagagcggc
ggcggcggctcgtcgtcgtcgggaggcggccgcgtcaagaagggcggcggcaagaagagc
ggcaagaagagttacctcagcggcggggccggcgcggcgggcggcggcggcgccgacccg
ggcaacaagaagtgggagcagaagcaggtgcagatcaagaccctggagggcgagttctcg
gtcaccatgtggtcctcagatgaaaaaaaagatattgaccatgagacagtggttgaagaa
cagatcattggagagaactcacctcctgattattcagaatatatgacaggaaagaaactt
cctcctggaggaatacctggcattgacctctcagatcccaaacaactggcagaatttgct
agaatgaagccaagaaaaattaaagaagatgatgctccaagaacaatagcttgccctcat
aaaggctgcacaaagatgttcagggataactcggccatgagaaaacatctgcacacccac
ggtcccagagtccacgtctgtgcagaatgtggcaaagcttttgttgagagttcaaaacta
aaacgacaccaactggttcatactggagagaagccctttcagtgcacgttcgaaggctgt
gggaaacgcttttcactggacttcaatttgcgcacacatgtgcgaatccataccggagac
aggccctatgtgtgccccttcgatggttgtaataagaagtttgctcagtcaactaacctg
aaatctcacatcttaacacatgctaaggccaaaaacaaccagtga

DBGET integrated database retrieval system