KEGG   Homo sapiens (human): 7529Help
Entry
7529              CDS       T01001                                 

Gene name
YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    7529 (YWHAB)
   04151 PI3K-Akt signaling pathway
    7529 (YWHAB)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    7529 (YWHAB)
   04114 Oocyte meiosis
    7529 (YWHAB)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    7529 (YWHAB)
  Infectious diseases
   05161 Hepatitis B
    7529 (YWHAB)
   05169 Epstein-Barr virus infection
    7529 (YWHAB)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7529 (YWHAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7529 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 Virulence_fact
Motif
Other DBs
NCBI-GeneID: 7529
NCBI-ProteinID: NP_003395
OMIM: 601289
HGNC: 12849
Ensembl: ENSG00000166913
Vega: OTTHUMG00000032549
Pharos: P31946(Tbio)
UniProt: P31946 V9HWD6
Structure
PDB: 

Position
20q13.12
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcga
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaac
gaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcc
tggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaa
caaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatg
cagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagac
gctggggagggagagaactaa

DBGET integrated database retrieval system