KEGG   Homo sapiens (human): 7529Help
Entry
7529              CDS       T01001                                 

Gene name
YWHAB, GW128, HEL-S-1, HS1, KCIP-1, YWHAA
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein beta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05160  Hepatitis C
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
nt06110  MAPK signaling (virus)
nt06163  Hepatitis C virus (HCV)
  Element
N00518  HCV Core to ERK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7529 (YWHAB)
   04151 PI3K-Akt signaling pathway
    7529 (YWHAB)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7529 (YWHAB)
   04114 Oocyte meiosis
    7529 (YWHAB)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    7529 (YWHAB)
  09172 Infectious disease: viral
   05161 Hepatitis B
    7529 (YWHAB)
   05160 Hepatitis C
    7529 (YWHAB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7529 (YWHAB)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7529 (YWHAB)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7529 (YWHAB)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7529 (YWHAB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 DUF4518
Motif
Other DBs
NCBI-GeneID: 7529
NCBI-ProteinID: NP_003395
OMIM: 601289
HGNC: 12849
Ensembl: ENSG00000166913
Vega: OTTHUMG00000032549
Pharos: P31946(Tbio)
UniProt: P31946 V9HWD6
Structure
PDB: 

Position
20q13.12
AA seq 246 aa AA seqDB search
MTMDKSELVQKAKLAEQAERYDDMAAAMKAVTEQGHELSNEERNLLSVAYKNVVGARRSS
WRVISSIEQKTERNEKKQQMGKEYREKIEAELQDICNDVLELLDKYLIPNATQPESKVFY
LKMKGDYFRYLSEVASGDNKQTTVSNSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFY
YEILNSPEKACSLAKTAFDEAIAELDTLNEESYKDSTLIMQLLRDNLTLWTSENQGDEGD
AGEGEN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggataaaagtgagctggtacagaaagccaaactcgctgagcaggctgagcga
tatgatgatatggctgcagccatgaaggcagtcacagaacaggggcatgaactctccaac
gaagagagaaatctgctctctgttgcctacaagaatgtggtaggcgcccgccgctcttcc
tggcgtgtcatctccagcattgagcagaaaacagagaggaatgagaagaagcagcagatg
ggcaaagagtaccgtgagaagatagaggcagaactgcaggacatctgcaatgatgttctg
gagctgttggacaaatatcttattcccaatgctacacaaccagaaagtaaggtgttctac
ttgaaaatgaaaggagattattttaggtatctttctgaagtggcatctggagacaacaaa
caaaccactgtgtcgaactcccagcaggcttaccaggaagcatttgaaattagtaagaaa
gaaatgcagcctacacacccaattcgtcttggtctggcactaaatttctcagtcttttac
tatgagattctaaactctcctgaaaaggcctgtagcctggcaaaaacggcatttgatgaa
gcaattgctgaattggatacgctgaatgaagagtcttataaagacagcactctgatcatg
cagttacttagggacaatctcactctgtggacatcggaaaaccagggagacgaaggagac
gctggggagggagagaactaa

DBGET integrated database retrieval system