KEGG   Homo sapiens (human): 7532Help
Entry
7532              CDS       T01001                                 

Gene name
YWHAG, 14-3-3GAMMA, EIEE56, PPP1R170
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7532 (YWHAG)
   04151 PI3K-Akt signaling pathway
    7532 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7532 (YWHAG)
   04114 Oocyte meiosis
    7532 (YWHAG)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    7532 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7532 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7532 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7532 (YWHAG)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7532 (YWHAG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7532 (YWHAG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7532 (YWHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 Peptidase_C98 Orbi_VP5 SF3A2 FlaC_arch
Motif
Other DBs
NCBI-GeneID: 7532
NCBI-ProteinID: NP_036611
OMIM: 605356
HGNC: 12852
Ensembl: ENSG00000170027
Vega: OTTHUMG00000022862
Pharos: P61981(Tbio)
UniProt: P61981
Structure
PDB: 

Position
7q11.23
AA seq 247 aa AA seqDB search
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtcgaatgag
gaacgaaaccttctgtctgtggcctacaagaacgttgtgggggcacgccgctcttcctgg
agggtcatcagtagcattgagcagaagacatctgcagacggcaatgagaagaagattgag
atggtccgtgcgtaccgggagaagatagagaaggagttggaggctgtgtgccaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtacgagagcaaa
gtgttctacctgaagatgaaaggggactactaccgctacctggctgaagtggccaccgga
gagaaaagggcgacggtggtggagtcctccgagaaggcctacagcgaagcccacgagatc
agcaaagagcacatgcagcccacccaccccatccgattaggcctggctcttaactactcc
gtcttctactatgagatccagaacgccccagagcaagcgtgccacttggccaagaccgcg
ttcgacgacgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgcgacaacctcacgctctggacgagcgaccagcaggacgac
gatggcggcgaaggcaacaattaa

DBGET integrated database retrieval system