KEGG   Homo sapiens (human): 7532Help
Entry
7532              CDS       T01001                                 

Gene name
YWHAG, 14-3-3GAMMA, EIEE56, PPP1R170
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein gamma
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Disease
H00606  Early infantile epileptic encephalopathy
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7532 (YWHAG)
   04151 PI3K-Akt signaling pathway
    7532 (YWHAG)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7532 (YWHAG)
   04114 Oocyte meiosis
    7532 (YWHAG)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    7532 (YWHAG)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    7532 (YWHAG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    7532 (YWHAG)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7532 (YWHAG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7532 (YWHAG)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7532 (YWHAG)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7532 (YWHAG)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7532 (YWHAG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 Peptidase_C98 Orbi_VP5 SF3A2
Motif
Other DBs
NCBI-GeneID: 7532
NCBI-ProteinID: NP_036611
OMIM: 605356
HGNC: 12852
Ensembl: ENSG00000170027
Vega: OTTHUMG00000022862
Pharos: P61981(Tbio)
UniProt: P61981
Structure
PDB: 

Position
7q11.23
AA seq 247 aa AA seqDB search
MVDREQLVQKARLAEQAERYDDMAAAMKNVTELNEPLSNEERNLLSVAYKNVVGARRSSW
RVISSIEQKTSADGNEKKIEMVRAYREKIEKELEAVCQDVLSLLDNYLIKNCSETQYESK
VFYLKMKGDYYRYLAEVATGEKRATVVESSEKAYSEAHEISKEHMQPTHPIRLGLALNYS
VFYYEIQNAPEQACHLAKTAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDD
DGGEGNN
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atggtggaccgcgagcaactggtgcagaaagcccggctggccgagcaggcggagcgctac
gacgacatggccgcggccatgaagaacgtgacagagctgaatgagccactgtcgaatgag
gaacgaaaccttctgtctgtggcctacaagaacgttgtgggggcacgccgctcttcctgg
agggtcatcagtagcattgagcagaagacatctgcagacggcaatgagaagaagattgag
atggtccgtgcgtaccgggagaagatagagaaggagttggaggctgtgtgccaggatgtg
ctgagcctgctggataactacctgatcaagaattgcagcgagacccagtacgagagcaaa
gtgttctacctgaagatgaaaggggactactaccgctacctggctgaagtggccaccgga
gagaaaagggcgacggtggtggagtcctccgagaaggcctacagcgaagcccacgagatc
agcaaagagcacatgcagcccacccaccccatccgattaggcctggctcttaactactcc
gtcttctactatgagatccagaacgccccagagcaagcgtgccacttggccaagaccgcg
ttcgacgacgccatcgccgagcttgacaccctcaacgaggactcctacaaggactccacg
ctcatcatgcagctcctccgcgacaacctcacgctctggacgagcgaccagcaggacgac
gatggcggcgaaggcaacaattaa

DBGET integrated database retrieval system