KEGG   Homo sapiens (human): 7533Help
Entry
7533              CDS       T01001                                 

Gene name
YWHAH, YWHA1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7533 (YWHAH)
   04151 PI3K-Akt signaling pathway
    7533 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7533 (YWHAH)
   04114 Oocyte meiosis
    7533 (YWHAH)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    7533 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    7533 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7533 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7533 (YWHAH)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7533 (YWHAH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7533 (YWHAH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7533 (YWHAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 CodY
Motif
Other DBs
NCBI-GeneID: 7533
NCBI-ProteinID: NP_003396
OMIM: 113508
HGNC: 12853
Ensembl: ENSG00000128245
Vega: OTTHUMG00000030833
Pharos: Q04917(Tbio)
UniProt: Q04917 A0A024R1K7 Q9H4N8
Structure
PDB: 

Position
22q12.3
AA seq 246 aa AA seqDB search
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgctatgaaggcggtgacagagctgaatgaacctctctccaatgaa
gatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcattagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaagggtgattactaccgctacttagcagaggtcgcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatc
agcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctcc
gtgttctactatgagatccagaatgcacctgagcaagcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctgatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

DBGET integrated database retrieval system