KEGG   Homo sapiens (human): 7533Help
Entry
7533              CDS       T01001                                 

Gene name
YWHAH, YWHA1
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
  KO
K16198  14-3-3 protein gamma/eta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7533 (YWHAH)
   04151 PI3K-Akt signaling pathway
    7533 (YWHAH)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7533 (YWHAH)
   04114 Oocyte meiosis
    7533 (YWHAH)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    7533 (YWHAH)
  09167 Infectious diseases
   05169 Epstein-Barr virus infection
    7533 (YWHAH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:hsa01009]
    7533 (YWHAH)
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7533 (YWHAH)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7533 (YWHAH)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     7533 (YWHAH)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7533 (YWHAH)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7533 (YWHAH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 DUF722 CodY
Motif
Other DBs
NCBI-GeneID: 7533
NCBI-ProteinID: NP_003396
OMIM: 113508
HGNC: 12853
Ensembl: ENSG00000128245
Vega: OTTHUMG00000030833
Pharos: Q04917(Tbio)
UniProt: Q04917 A0A024R1K7 Q9H4N8
Structure
PDB: 

Position
22q12.3
AA seq 246 aa AA seqDB search
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgggggaccgggagcagctgctgcagcgggcgcggctggccgagcaggcggagcgctac
gacgacatggcctccgctatgaaggcggtgacagagctgaatgaacctctctccaatgaa
gatcgaaatctcctctctgtggcctacaagaatgtggttggtgccaggcgatcttcctgg
agggtcattagcagcattgagcagaaaaccatggctgatggaaacgaaaagaaattggag
aaagttaaagcttaccgggagaagattgagaaggagctggagacagtttgcaatgatgtc
ctgtctctgcttgacaagttcctgatcaagaactgcaatgatttccagtatgagagcaag
gtgttttacctgaaaatgaagggtgattactaccgctacttagcagaggtcgcttctggg
gagaagaaaaacagtgtggtcgaagcttctgaagctgcctacaaggaagcctttgaaatc
agcaaagagcagatgcaacccacgcatcccatccggctgggcctggccctcaacttctcc
gtgttctactatgagatccagaatgcacctgagcaagcctgcctcttagccaaacaagcc
ttcgatgatgccatagctgagctggacacactaaacgaggattcctataaggactccacg
ctgatcatgcagttgctgcgagacaacctcaccctctggacgagcgaccagcaggatgaa
gaagcaggagaaggcaactga

DBGET integrated database retrieval system