KEGG   Homo sapiens (human): 7534Help
Entry
7534              CDS       T01001                                 

Gene name
YWHAZ, 14-3-3-zeta, HEL-S-3, HEL-S-93, HEL4, KCIP-1, YWHAD
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05161  Hepatitis B
hsa05169  Epstein-Barr virus infection
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7534 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    7534 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7534 (YWHAZ)
   04114 Oocyte meiosis
    7534 (YWHAZ)
 09160 Human Diseases
  09161 Cancers
   05203 Viral carcinogenesis
    7534 (YWHAZ)
  09167 Infectious diseases
   05130 Pathogenic Escherichia coli infection
    7534 (YWHAZ)
   05161 Hepatitis B
    7534 (YWHAZ)
   05169 Epstein-Barr virus infection
    7534 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7534 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7534 (YWHAZ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7534 (YWHAZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7534 (YWHAZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98
Motif
Other DBs
NCBI-GeneID: 7534
NCBI-ProteinID: NP_001129171
OMIM: 601288
HGNC: 12855
Ensembl: ENSG00000164924
Vega: OTTHUMG00000134291
Pharos: P63104(Tbio)
UniProt: P63104 D0PNI1
Structure
PDB: 

Position
8q22.3
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system