KEGG   Homo sapiens (human): 7534Help
Entry
7534              CDS       T01001                                 

Gene name
YWHAZ, 14-3-3-zeta, HEL-S-3, HEL-S-93, HEL4, KCIP-1, YWHAD
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
hsa04114  Oocyte meiosis
hsa04151  PI3K-Akt signaling pathway
hsa04390  Hippo signaling pathway
hsa05130  Pathogenic Escherichia coli infection
hsa05161  Hepatitis B
hsa05203  Viral carcinogenesis
Network
N00267  HBV HBx to host-cell-protein activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    7534 (YWHAZ)
   04151 PI3K-Akt signaling pathway
    7534 (YWHAZ)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    7534 (YWHAZ)
   04114 Oocyte meiosis
    7534 (YWHAZ)
 09160 Human Diseases
  09161 Cancers: Overview
   05203 Viral carcinogenesis
    7534 (YWHAZ)
  09171 Infectious diseases: Bacterial
   05130 Pathogenic Escherichia coli infection
    7534 (YWHAZ)
  09172 Infectious diseases: Viral
   05161 Hepatitis B
    7534 (YWHAZ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:hsa03400]
    7534 (YWHAZ)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    7534 (YWHAZ)
DNA repair and recombination proteins [BR:hsa03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    7534 (YWHAZ)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   7534 (YWHAZ)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM Peptidase_C98 CSN7a_helixI
Motif
Other DBs
NCBI-GeneID: 7534
NCBI-ProteinID: NP_001129171
OMIM: 601288
HGNC: 12855
Ensembl: ENSG00000164924
Vega: OTTHUMG00000134291
Pharos: P63104(Tbio)
UniProt: P63104 D0PNI1
Structure
PDB: 

Position
8q22.3
AA seq 245 aa AA seqDB search
MDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRSSWR
VVSSIEQKTEGAEKKQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVFYLK
MKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISKKEMQPTHPIRLGLALNFSVFYYE
ILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTSDTQGDEAEAG
EGGEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggataaaaatgagctggttcagaaggccaaactggccgagcaggctgagcgatatgat
gacatggcagcctgcatgaagtctgtaactgagcaaggagctgaattatccaatgaggag
aggaatcttctctcagttgcttataaaaatgttgtaggagcccgtaggtcatcttggagg
gtcgtctcaagtattgaacaaaagacggaaggtgctgagaaaaaacagcagatggctcga
gaatacagagagaaaattgagacggagctaagagatatctgcaatgatgtactgtctctt
ttggaaaagttcttgatccccaatgcttcacaagcagagagcaaagtcttctatttgaaa
atgaaaggagattactaccgttacttggctgaggttgccgctggtgatgacaagaaaggg
attgtcgatcagtcacaacaagcataccaagaagcttttgaaatcagcaaaaaggaaatg
caaccaacacatcctatcagactgggtctggcccttaacttctctgtgttctattatgag
attctgaactccccagagaaagcctgctctcttgcaaagacagcttttgatgaagccatt
gctgaacttgatacattaagtgaagagtcatacaaagacagcacgctaataatgcaatta
ctgagagacaacttgacattgtggacatcggatacccaaggagacgaagctgaagcagga
gaaggaggggaaaattaa

DBGET integrated database retrieval system