KEGG   Homo sapiens (human): 7535Help
Entry
7535              CDS       T01001                                 

Gene name
ZAP70, ADMIO2, IMD48, SRK, STCD, STD, TZK, ZAP-70
Definition
(RefSeq) zeta chain of T cell receptor associated protein kinase 70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7535 (ZAP70)
   04064 NF-kappa B signaling pathway
    7535 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    7535 (ZAP70)
   04660 T cell receptor signaling pathway
    7535 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    7535 (ZAP70)
   04659 Th17 cell differentiation
    7535 (ZAP70)
 09160 Human Diseases
  09163 Immune diseases
   05340 Primary immunodeficiency
    7535 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7535 (ZAP70)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7535 (ZAP70)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SYK family
   7535 (ZAP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 7535
NCBI-ProteinID: NP_001070
OMIM: 176947
HGNC: 12858
Ensembl: ENSG00000115085
Vega: OTTHUMG00000153060
Pharos: P43403(Tchem)
UniProt: P43403
Structure
PDB: 

Position
2q11.2
AA seq 619 aa AA seqDB search
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccccgcggcgcacctgcccttcttctacggcagcatctcgcgtgccgaggcc
gaggagcacctgaagctggcgggcatggcggacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctgtcgctcgtgcacgatgtgcgcttccaccactttccc
atcgagcgccagctcaacggcacctacgccattgccggcggcaaagcgcactgtggaccg
gcagagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgcaag
ccgtgcaaccggccgtcgggcctcgagccgcagccgggggtcttcgactgcctgcgagac
gccatggtgcgtgactacgtgcgccagacgtggaagctggagggcgaggccctggagcag
gccatcatcagccaggccccgcaggtggagaagctcattgctacgacggcccacgagcgg
atgccctggtaccacagcagcctgacgcgtgaggaggccgagcgcaaactttactctggg
gcgcagaccgacggcaagttcctgctgaggccgcggaaggagcagggcacatacgccctg
tccctcatctatgggaagacggtgtaccactacctcatcagccaagacaaggcgggcaag
tactgcattcccgagggcaccaagtttgacacgctctggcagctggtggagtatctgaag
ctgaaggcggacgggctcatctactgcctgaaggaggcctgccccaacagcagtgccagc
aacgcctcaggggctgctgctcccacactcccagcccacccatccacgttgactcatcct
cagagacgaatcgacaccctcaactcagatggatacacccctgagccagcacgcataacg
tccccagacaaaccgcggccgatgcccatggacacgagcgtgtatgagagcccctacagc
gacccagaggagctcaaggacaagaagctcttcctgaagcgcgataacctcctcatagct
gacattgaacttggctgcggcaactttggctcagtgcgccagggcgtgtaccgcatgcgc
aagaagcagatcgacgtggccatcaaggtgctgaagcagggcacggagaaggcagacacg
gaagagatgatgcgcgaggcgcagatcatgcaccagctggacaacccctacatcgtgcgg
ctcattggcgtctgccaggccgaggccctcatgctggtcatggagatggctgggggcggg
ccgctgcacaagttcctggtcggcaagagggaggagatccctgtgagcaatgtggccgag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaactttgtgcaccgt
gacctggcggcccgcaacgtcctgctggttaaccggcactacgccaagatcagcgacttt
ggcctctccaaagcactgggtgccgacgacagctactacactgcccgctcagcagggaag
tggccgctcaagtggtacgcacccgaatgcatcaacttccgcaagttctccagccgcagc
gatgtctggagctatggggtcaccatgtgggaggccttgtcctacggccagaagccctac
aagaagatgaaagggccggaggtcatggccttcatcgagcagggcaagcggatggagtgc
ccaccagagtgtccacccgaactgtacgcactcatgagtgactgctggatctacaagtgg
gaggatcgccccgacttcctgaccgtggagcagcgcatgcgagcctgttactacagcctg
gccagcaaggtggaagggcccccaggcagcacacagaaggctgaggctgcctgtgcctga

DBGET integrated database retrieval system