KEGG   Homo sapiens (human): 7535Help
Entry
7535              CDS       T01001                                 

Gene name
ZAP70, ADMIO2, IMD48, SRK, STCD, STD, TZK, ZAP-70
Definition
(RefSeq) zeta chain of T cell receptor associated protein kinase 70
  KO
K07360  tyrosine-protein kinase ZAP-70 [EC:2.7.10.2]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04014  Ras signaling pathway
hsa04064  NF-kappa B signaling pathway
hsa04650  Natural killer cell mediated cytotoxicity
hsa04658  Th1 and Th2 cell differentiation
hsa04659  Th17 cell differentiation
hsa04660  T cell receptor signaling pathway
hsa05135  Yersinia infection
hsa05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05340  Primary immunodeficiency
Disease
H00093  Combined immunodeficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    7535 (ZAP70)
   04064 NF-kappa B signaling pathway
    7535 (ZAP70)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    7535 (ZAP70)
   04660 T cell receptor signaling pathway
    7535 (ZAP70)
   04658 Th1 and Th2 cell differentiation
    7535 (ZAP70)
   04659 Th17 cell differentiation
    7535 (ZAP70)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    7535 (ZAP70)
  09163 Immune disease
   05340 Primary immunodeficiency
    7535 (ZAP70)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    7535 (ZAP70)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    7535 (ZAP70)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     7535 (ZAP70)
Protein kinases [BR:hsa01001]
 Non-receptor tyrosine kinases
  SYK family
   7535 (ZAP70)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 Haspin_kinase Kdo
Motif
Other DBs
NCBI-GeneID: 7535
NCBI-ProteinID: NP_001070
OMIM: 176947
HGNC: 12858
Ensembl: ENSG00000115085
Vega: OTTHUMG00000153060
Pharos: P43403(Tchem)
UniProt: P43403
Structure
PDB: 

Position
2q11.2
AA seq 619 aa AA seqDB search
MPDPAAHLPFFYGSISRAEAEEHLKLAGMADGLFLLRQCLRSLGGYVLSLVHDVRFHHFP
IERQLNGTYAIAGGKAHCGPAELCEFYSRDPDGLPCNLRKPCNRPSGLEPQPGVFDCLRD
AMVRDYVRQTWKLEGEALEQAIISQAPQVEKLIATTAHERMPWYHSSLTREEAERKLYSG
AQTDGKFLLRPRKEQGTYALSLIYGKTVYHYLISQDKAGKYCIPEGTKFDTLWQLVEYLK
LKADGLIYCLKEACPNSSASNASGAAAPTLPAHPSTLTHPQRRIDTLNSDGYTPEPARIT
SPDKPRPMPMDTSVYESPYSDPEELKDKKLFLKRDNLLIADIELGCGNFGSVRQGVYRMR
KKQIDVAIKVLKQGTEKADTEEMMREAQIMHQLDNPYIVRLIGVCQAEALMLVMEMAGGG
PLHKFLVGKREEIPVSNVAELLHQVSMGMKYLEEKNFVHRDLAARNVLLVNRHYAKISDF
GLSKALGADDSYYTARSAGKWPLKWYAPECINFRKFSSRSDVWSYGVTMWEALSYGQKPY
KKMKGPEVMAFIEQGKRMECPPECPPELYALMSDCWIYKWEDRPDFLTVEQRMRACYYSL
ASKVEGPPGSTQKAEAACA
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgccagaccccgcggcgcacctgcccttcttctacggcagcatctcgcgtgccgaggcc
gaggagcacctgaagctggcgggcatggcggacgggctcttcctgctgcgccagtgcctg
cgctcgctgggcggctatgtgctgtcgctcgtgcacgatgtgcgcttccaccactttccc
atcgagcgccagctcaacggcacctacgccattgccggcggcaaagcgcactgtggaccg
gcagagctctgcgagttctactcgcgcgaccccgacgggctgccctgcaacctgcgcaag
ccgtgcaaccggccgtcgggcctcgagccgcagccgggggtcttcgactgcctgcgagac
gccatggtgcgtgactacgtgcgccagacgtggaagctggagggcgaggccctggagcag
gccatcatcagccaggccccgcaggtggagaagctcattgctacgacggcccacgagcgg
atgccctggtaccacagcagcctgacgcgtgaggaggccgagcgcaaactttactctggg
gcgcagaccgacggcaagttcctgctgaggccgcggaaggagcagggcacatacgccctg
tccctcatctatgggaagacggtgtaccactacctcatcagccaagacaaggcgggcaag
tactgcattcccgagggcaccaagtttgacacgctctggcagctggtggagtatctgaag
ctgaaggcggacgggctcatctactgcctgaaggaggcctgccccaacagcagtgccagc
aacgcctcaggggctgctgctcccacactcccagcccacccatccacgttgactcatcct
cagagacgaatcgacaccctcaactcagatggatacacccctgagccagcacgcataacg
tccccagacaaaccgcggccgatgcccatggacacgagcgtgtatgagagcccctacagc
gacccagaggagctcaaggacaagaagctcttcctgaagcgcgataacctcctcatagct
gacattgaacttggctgcggcaactttggctcagtgcgccagggcgtgtaccgcatgcgc
aagaagcagatcgacgtggccatcaaggtgctgaagcagggcacggagaaggcagacacg
gaagagatgatgcgcgaggcgcagatcatgcaccagctggacaacccctacatcgtgcgg
ctcattggcgtctgccaggccgaggccctcatgctggtcatggagatggctgggggcggg
ccgctgcacaagttcctggtcggcaagagggaggagatccctgtgagcaatgtggccgag
ctgctgcaccaggtgtccatggggatgaagtacctggaggagaagaactttgtgcaccgt
gacctggcggcccgcaacgtcctgctggttaaccggcactacgccaagatcagcgacttt
ggcctctccaaagcactgggtgccgacgacagctactacactgcccgctcagcagggaag
tggccgctcaagtggtacgcacccgaatgcatcaacttccgcaagttctccagccgcagc
gatgtctggagctatggggtcaccatgtgggaggccttgtcctacggccagaagccctac
aagaagatgaaagggccggaggtcatggccttcatcgagcagggcaagcggatggagtgc
ccaccagagtgtccacccgaactgtacgcactcatgagtgactgctggatctacaagtgg
gaggatcgccccgacttcctgaccgtggagcagcgcatgcgagcctgttactacagcctg
gccagcaaggtggaagggcccccaggcagcacacagaaggctgaggctgcctgtgcctga

DBGET integrated database retrieval system