KEGG   Homo sapiens (human): 7544Help
Entry
7544              CDS       T01001                                 

Gene name
ZFY, ZNF911
Definition
(RefSeq) zinc finger protein Y-linked
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Zfx_Zfy_act zf-C2H2 zf-H2C2_2 zf-C2H2_4 zf-H2C2_5 zf-C2H2_jaz zinc_ribbon_15 zf-C2H2_3rep zf-met zf-BED zf-C2H2_11
Motif
Other DBs
NCBI-GeneID: 7544
NCBI-ProteinID: NP_003402
OMIM: 490000
HGNC: 12870
Ensembl: ENSG00000067646
Vega: OTTHUMG00000036159
Pharos: P08048(Tbio)
UniProt: P08048
Structure
PDB: 

Position
Yp11.2
AA seq 801 aa AA seqDB search
MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAVFVSNIVDSDITVHNFVPDDP
DSVVIQDVVEDVVIEEDVQCSDILEEADVSENVIIPEQVLDSDVTEEVSLPHCTVPDDVL
ASDITSTSMSMPEHVLTSESMHVCDIGHVEHMVHDSVVEAEIITDPLTSDIVSEEVLVAD
CAPEAVIDASGISVDQQDNDKASCEDYLMISLDDAGKIEHDGSTGVTIDAESEMDPCKVD
STCPEVIKVYIFKADPGEDDLGGTVDIVESEPENDHGVELLDQNSSIRVPREKMVYMTVN
DSQQEDEDLNVAEIADEVYMEVIVGEEDAAVAAAAAAVHEQQIDEDEMKTFVPIAWAAAY
GNNSDGIENRNGTASALLHIDESAGLGRLAKQKPKKKRRPDSRQYQTAIIIGPDGHPLTV
YPCMICGKKFKSRGFLKRHMKNHPEHLAKKKYHCTDCDYTTNKKISLHNHLESHKLTSKA
EKAIECDECGKHFSHAGALFTHKMVHKEKGANKMHKCKFCEYETAEQGLLNRHLLAVHSK
NFPHICVECGKGFRHPSELRKHMRIHTGEKPYQCQYCEYRSADSSNLKTHIKTKHSKEMP
FKCDICLLTFSDTKEVQQHTLVHQESKTHQCLHCDHKSSNSSDLKRHVISVHTKDYPHKC
EMCEKGFHRPSELKKHVAVHKGKKMHQCRHCDFKIADPFVLSRHILSVHTKDLPFRCKRC
RKGFRQQNELKKHMKTHSGRKVYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEYCKKG
FRRPSEKNQHIMRHHKEVGLP
NT seq 2406 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatgaatttgaattgcagccacaagagccaaactcattttttgatggaata
ggagctgatgctacacacatggatggtgatcagattgttgtggaaatacaagaagcagtt
tttgtttctaatattgtggattctgacataactgtgcataactttgttcctgatgaccca
gactcagttgtaatccaagatgttgttgaagatgttgtcatagaggaggatgttcagtgc
tcagatatcttagaagaggcagatgtatctgaaaatgtcatcattcctgagcaagtgctg
gactcagatgtaactgaagaagtttctttaccacactgcacagtcccagatgatgtttta
gcttctgacattacttcaacctcaatgtctatgccagaacatgttttaacgagtgaatcc
atgcatgtgtgtgacattggacatgttgaacatatggtgcatgatagtgtagtggaagca
gaaatcattactgatcctctgacgagtgacatagtttcagaagaagtattggtagcagac
tgtgcccctgaagcagtcatagatgccagcgggatctcagtggaccagcaagataatgac
aaagccagctgtgaggactacctaatgatttcgttggatgatgctggcaaaatagaacat
gatggttccactggagtgaccatcgatgcagaatcagaaatggatccttgtaaagtggat
agcacttgtcctgaagtcatcaaggtgtacatttttaaagctgaccctggagaagatgac
ttaggtggaactgtagacattgtggagagtgaacctgaaaatgatcatggagttgaacta
cttgatcagaacagcagtattcgtgttcccagggaaaagatggtttatatgactgtcaat
gactctcaacaagaagatgaagatttaaatgttgctgaaattgctgatgaagtttatatg
gaagtgatcgtaggagaggaggatgctgctgttgcagcagcagcagctgctgtgcatgag
cagcaaattgatgaggatgaaatgaaaaccttcgtaccaattgcatgggcagcagcttat
ggtaataattctgatggaattgaaaaccggaatggcactgcaagtgccctcttgcacata
gatgagtctgctggccttggcagactggctaaacagaaaccaaagaaaaagagaagacct
gattccaggcagtaccaaacagcaataattattggccctgatggtcatcctttgactgtc
tatccttgcatgatttgtgggaagaagtttaagtcgaggggttttttgaaaagacacatg
aaaaaccatcctgaacaccttgccaagaagaagtaccactgtactgactgtgattacact
accaataagaagataagtttacataaccacctggagagccacaagctgaccagcaaggca
gagaaggccattgaatgtgatgagtgtgggaagcatttttctcatgcaggggctttgttt
actcacaaaatggtgcataaggaaaaaggggccaacaaaatgcacaagtgtaaattctgt
gaatatgagacagctgaacaggggttattgaatcgccacctcttggcagtccacagcaag
aactttcctcatatttgtgtggagtgtggtaaaggtttccgacacccgtcggaactgaga
aagcacatgcgaatccataccggcgagaagccataccaatgccagtactgtgaatatagg
tctgcagactcttctaacttgaaaacacatataaaaacaaagcatagtaaagagatgcca
ttcaagtgtgacatttgtcttctgactttctcagataccaaagaagtgcagcaacatact
cttgtccaccaagaaagcaaaacacatcagtgtttgcattgcgaccacaagagttcaaac
tcaagtgatttgaaacgacatgtaatttcagttcatacgaaagactatcctcataagtgt
gagatgtgcgagaaaggctttcacaggccttcagaacttaagaaacatgtggctgtccac
aaaggtaaaaaaatgcaccaatgtagacattgtgactttaagattgcagacccatttgtt
ctaagtcgccatattctctcagttcacacaaaggatcttccatttaggtgtaagagatgt
agaaagggatttaggcaacaaaatgagcttaaaaagcatatgaagacacacagtggcagg
aaagtatatcagtgtgagtactgtgagtatagcactacagatgcctcaggctttaaacgg
cacgttatttccattcatacaaaagactatcctcatcggtgtgagtactgcaagaaaggc
ttccgaagaccttcagaaaagaaccagcacataatgagacaccataaagaagttggtctg
ccctaa

DBGET integrated database retrieval system