KEGG   Homo sapiens (human): 7546Help
Entry
7546              CDS       T01001                                 

Gene name
ZIC2, HPE5
Definition
(RefSeq) Zic family member 2
  KO
K06235  zinc finger protein ZIC 2
Organism
hsa  Homo sapiens (human)
Disease
H00267  Holoprosencephaly
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7546 (ZIC2)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7546 (ZIC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf_ZIC zf-C2H2 zf-H2C2_2 zf-C2H2_jaz zf-C2H2_6 zf-C2H2_4 zf-met zf-C2H2_8
Motif
Other DBs
NCBI-GeneID: 7546
NCBI-ProteinID: NP_009060
OMIM: 603073
HGNC: 12873
Ensembl: ENSG00000043355
Vega: OTTHUMG00000017279
Pharos: O95409(Tbio)
UniProt: O95409 A0A024RDY6
Position
13q32.3
AA seq 532 aa AA seqDB search
MLLDAGPQFPAIGVGSFARHHHHSAAAAAAAAAEMQDRELSLAAAQNGFVDSAAAHMGAF
KLNPGAHELSPGQSSAFTSQGPGAYPGSAAAAAAAAALGPHAAHVGSYSGPPFNSTRDFL
FRSRGFGDSAPGGGQHGLFGPGAGGLHHAHSDAQGHLLFPGLPEQHGPHGSQNVLNGQMR
LGLPGEVFGRSEQYRQVASPRTDPYSAAQLHNQYGPMNMNMGMNMAAAAAHHHHHHHHHP
GAFFRYMRQQCIKQELICKWIDPEQLSNPKKSCNKTFSTMHELVTHVSVEHVGGPEQSNH
VCFWEECPREGKPFKAKYKLVNHIRVHTGEKPFPCPFPGCGKVFARSENLKIHKRTHTGE
KPFQCEFEGCDRRFANSSDRKKHMHVHTSDKPYLCKMCDKSYTHPSSLRKHMKVHESSPQ
GSESSPAASSGYESSTPPGLVSPSAEPQSSSNLSPAAAAAAAAAAAAAAAVSAVHRGGGS
GSGGAGGGSGGGSGSGGGGGGAGGGGGGSSGGGSGTAGGHSGLSSNFNEWYV
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgctcctggacgcgggtccgcagttcccggccatcggggtgggcagcttcgcgcgccac
catcaccactccgccgcggcggcggcggcggctgccgccgagatgcaggaccgtgaactg
agcctggcggcggcgcagaacggcttcgttgactccgccgccgcgcacatgggagccttc
aagctcaacccgggcgcgcacgagctgtccccgggccagagctcggcgttcacgtcgcag
ggccccggcgcctaccccggctccgctgcggctgccgctgcggccgcagcgctcgggccc
cacgccgcgcacgttggctcctactctgggccgcccttcaactccacccgggacttcctg
ttccgcagccgcggcttcggggactcggcgccgggcggcgggcagcacgggctgttcggg
ccgggcgcgggcggcctgcaccacgcgcactcggacgcgcagggccacctcctcttcccg
ggcctgccagagcagcacgggccgcacggctcgcagaatgtgctcaacgggcagatgcgc
ctcgggctgcccggcgaggtgttcgggcgctcggagcaataccgccaggtggccagcccg
cggaccgacccctactcggcggcgcaactccacaaccagtacggccccatgaatatgaac
atgggtatgaacatggcagcagccgcggcccaccaccaccaccaccaccaccaccacccc
ggtgcctttttccgctatatgcggcagcagtgcatcaagcaggagctaatctgcaagtgg
atcgaccccgagcaactgagcaatcccaagaagagctgcaacaaaactttcagcaccatg
cacgagctggtgacacacgtctcggtggagcacgtcggcggcccggagcagagcaaccac
gtctgcttctgggaggagtgtccgcgcgagggcaagcccttcaaggccaaatacaaactg
gtcaaccacatccgcgtgcacacaggcgagaaacccttcccctgccccttcccgggctgt
ggcaaagtcttcgcgcgctccgagaacctcaagatccacaaaaggacccacacaggggag
aagccgttccagtgtgagtttgagggctgcgaccggcgcttcgccaacagcagcgacagg
aagaagcacatgcacgtccacacctccgataagccctatctctgcaagatgtgcgacaag
tcctacacgcaccccagctcgctgcggaagcacatgaaggtccatgagtcctccccgcag
ggctctgaatcctccccggccgccagctccggctatgagtcgtccacgcccccggggctg
gtgtcccccagcgccgagccccagagcagctccaacctgtccccagcggcggcggcagcg
gcggcggcggctgcggcggcggcggccgcggtgtccgcggtgcaccggggcggaggctcg
ggcagtggcggcgcgggaggcggctcaggcggcggcagcggcagtggcgggggcggcggc
ggggcgggcggcgggggcggcggcagctctggcgggggcagcgggacagccgggggtcac
agcggcctctcctccaacttcaatgaatggtacgtgtga

DBGET integrated database retrieval system