KEGG   Homo sapiens (human): 7551Help
Entry
7551              CDS       T01001                                 

Gene name
ZNF3, A8-51, HF.12, KOX25, PP838, Zfp113
Definition
(RefSeq) zinc finger protein 3
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7551 (ZNF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7551 (ZNF3)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Other Cys2His2 zinc factors
    7551 (ZNF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_11 zf-C2H2_jaz zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 7551
NCBI-ProteinID: NP_001265213
OMIM: 194510
HGNC: 13089
Ensembl: ENSG00000166526
Vega: OTTHUMG00000154596
Pharos: P17036(Tdark)
UniProt: P17036
Position
7q22.1
AA seq 446 aa AA seqDB search
METQADLVSQEPQALLDSALPSKVPAFSDKDSLGDEMLAAALLKAKSQELVTFEDVAVYF
IRKEWKRLEPAQRDLYRDVMLENYGNVFSLDRETRTENDQEISEDTRSHGVLLGRFQKDI
SQGLKFKEAYEREVSLKRPLGNSPGERLNRKMPDFGQVTVEEKLTPRGERSEKYNDFGNS
FTVNSNLISHQRLPVGDRPHKCDECSKSFNRTSDLIQHQRIHTGEKPYECNECGKAFSQS
SHLIQHQRIHTGEKPYECSDCGKTFSCSSALILHRRIHTGEKPYECNECGKTFSWSSTLT
HHQRIHTGEKPYACNECGKAFSRSSTLIHHQRIHTGEKPYECNECGKAFSQSSHLYQHQR
IHTGEKPYECMECGGKFTYSSGLIQHQRIHTGENPYECSECGKAFRYSSALVRHQRIHTG
EKPLNGIGMSKSSLRVTTELNIREST
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atggaaactcaggctgatctcgtatctcaggaacctcaggccctgcttgacagtgctctt
ccttcaaaagttcctgccttttccgacaaggacagcctgggggatgagatgttggcggct
gcgctcctaaaggccaagtcccaggagctggtaacctttgaggatgtagctgtgtacttc
atccggaaggagtggaagcgtttggaacctgctcagagggacctctatagagatgtgatg
ctggagaattacgggaatgtgttctcactggatcgtgagaccaggactgaaaatgatcaa
gaaatttctgaagacacaagatcacatggggtcctactgggaagatttcaaaaggatatt
tctcagggtctcaagtttaaagaagcctatgaacgagaagtcagtctgaaaaggccgctg
gggaactcccctggagaaagactgaacaggaaaatgccagattttggtcaagtgacagtt
gaggagaagctaacccccaggggagagagaagcgagaaatataatgattttgggaacagc
ttcactgtgaattccaaccttatctcacatcagagactccccgtgggagacagaccccat
aagtgtgatgaatgtagcaagagctttaatcgaacttcagaccttattcaacatcagaga
atccacactggggaaaagccctatgaatgtaatgagtgtgggaaggccttcagccagagc
tcacaccttattcagcatcagagaatccacactggggaaaaaccttatgaatgtagtgat
tgtgggaaaaccttcagctgtagctctgccctcattctgcatcggaggatccacacgggg
gagaaaccctatgaatgtaatgagtgtgggaagaccttcagctggagctccaccctcacc
caccatcagagaatccacactggtgagaaaccctacgcctgcaatgaatgtgggaaggcc
ttcagcaggagctcaacccttattcaccatcagagaatccacactggagaaaaaccctat
gaatgtaatgaatgtgggaaagccttcagccagagctcacacctctatcagcaccagaga
atccacactggagagaagccctacgaatgtatggaatgtggaggaaagtttacctacagt
tcaggccttattcagcatcaaagaatccacaccggggagaacccctatgaatgtagtgag
tgtgggaaagccttcaggtacagctcggctcttgttcgccatcagagaattcacactgga
gagaagcctttgaatgggatcggcatgagcaaaagctccctcagagttacgaccgagtta
aatatcagagagtccacgtga

DBGET integrated database retrieval system