KEGG   Homo sapiens (human): 7556Help
Entry
7556              CDS       T01001                                 

Gene name
ZNF10, KOX1
Definition
(RefSeq) zinc finger protein 10
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7556 (ZNF10)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7556 (ZNF10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB Zn-ribbon_8 zf-C2H2_6 zf-C2H2_jaz zf-trcl zinc_ribbon_15 zf-C2HC_2 DUF3268
Motif
Other DBs
NCBI-GeneID: 7556
NCBI-ProteinID: NP_056209
OMIM: 194538
HGNC: 12879
Ensembl: ENSG00000256223
Vega: OTTHUMG00000167944
Pharos: P21506(Tbio)
UniProt: P21506 Q9UG14
Position
12q24.33
AA seq 573 aa AA seqDB search
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLV
LREYFHKRDSHTKSLKHDLVLNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKC
PDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVH
SSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQ
RIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHT
GEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggatgctaagtcactaactgcctggtcccggacactggtgaccttcaaggatgtattt
gtggacttcaccagggaggagtggaagctgctggacactgctcagcagatcgtgtacaga
aatgtgatgctggagaactataagaacctggtttccttgggttatcagcttactaagcca
gatgtgatcctccggttggagaagggagaagagccctggctggtggagagagaaattcac
caagagacccatcctgattcagagactgcatttgaaatcaaatcatcagtttccagcagg
agcatttttaaagataagcaatcctgtgacattaaaatggaaggaatggcaaggaatgat
ctctggtatttgtcattagaagaagtctggaaatgtagagaccagttagacaagtatcag
gaaaacccagagagacatttgaggcaagtggcattcacccaaaagaaagtacttactcag
gagagagtctctgaaagtggtaaatatgggggaaactgtcttcttcctgctcagctagta
ctgagagagtatttccataaacgtgactcacatactaaaagtttaaaacatgatttagtt
cttaatggtcatcaggacagttgtgcaagtaacagtaatgaatgtggtcaaactttctgt
caaaacattcaccttattcagtttgcaagaactcacacaggtgataaatcctacaaatgc
cctgataatgacaactctcttactcatggttcatctcttggtatatcaaagggcatacat
agagagaaaccctatgaatgtaaggaatgtggaaaattcttcagctggcgctctaatctt
actaggcatcagcttattcatactggagaaaaaccctatgagtgtaaagaatgtggaaag
tctttcagccggagttctcacctcattggacatcaaaagacccatactggtgaggaaccc
tatgaatgtaaagaatgtggaaaatccttcagctggttctctcaccttgttactcatcag
agaactcatacaggagacaaactgtacacatgtaatcagtgtgggaaatcttttgttcat
agctctaggcttattagacaccagaggacacatactggagagaaaccctatgaatgtcct
gaatgtgggaaatctttcagacagagcacacatctcattctgcatcagagaacccatgtg
agagtgaggccctatgaatgcaatgaatgtggaaagtcttacagccagagatctcacctt
gttgtgcatcatagaattcacactggactaaaaccttttgagtgtaaggattgtggaaaa
tgttttagtcgaagctctcacctttattcacatcaaagaacccacactggagagaaacca
tatgagtgtcatgattgtggaaaatctttcagccagagttctgcccttattgtgcatcag
aggatacacactggagagaaaccatatgaatgctgtcagtgtgggaaagccttcatccgg
aagaatgacctcattaagcaccagagaattcatgttggagaagagacctataaatgtaat
caatgtggcattatcttcagccagaactctccatttatagttcatcaaatagctcacact
ggagagcagttcttaacatgcaatcaatgtgggacagcgcttgttaatacctctaacctt
attggataccagacaaatcatattagagaaaatgcttactaa

DBGET integrated database retrieval system