KEGG   Homo sapiens (human): 7556
Entry
7556              CDS       T01001                                 
Symbol
ZNF10, KOX1
Name
(RefSeq) zinc finger protein 10
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    7556 (ZNF10)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7556 (ZNF10)
Transcription factors [BR:hsa03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 others
    7556 (ZNF10)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 KRAB zf-C2H2_6 Zn-ribbon_8 zf-C2H2_jaz HVO_2753_ZBP zf-trcl
Other DBs
NCBI-GeneID: 7556
NCBI-ProteinID: NP_056209
OMIM: 194538
HGNC: 12879
Ensembl: ENSG00000256223
UniProt: P21506 Q9UG14
Position
12:133130627..133159465
AA seq 573 aa
MDAKSLTAWSRTLVTFKDVFVDFTREEWKLLDTAQQIVYRNVMLENYKNLVSLGYQLTKP
DVILRLEKGEEPWLVEREIHQETHPDSETAFEIKSSVSSRSIFKDKQSCDIKMEGMARND
LWYLSLEEVWKCRDQLDKYQENPERHLRQVAFTQKKVLTQERVSESGKYGGNCLLPAQLV
LREYFHKRDSHTKSLKHDLVLNGHQDSCASNSNECGQTFCQNIHLIQFARTHTGDKSYKC
PDNDNSLTHGSSLGISKGIHREKPYECKECGKFFSWRSNLTRHQLIHTGEKPYECKECGK
SFSRSSHLIGHQKTHTGEEPYECKECGKSFSWFSHLVTHQRTHTGDKLYTCNQCGKSFVH
SSRLIRHQRTHTGEKPYECPECGKSFRQSTHLILHQRTHVRVRPYECNECGKSYSQRSHL
VVHHRIHTGLKPFECKDCGKCFSRSSHLYSHQRTHTGEKPYECHDCGKSFSQSSALIVHQ
RIHTGEKPYECCQCGKAFIRKNDLIKHQRIHVGEETYKCNQCGIIFSQNSPFIVHQIAHT
GEQFLTCNQCGTALVNTSNLIGYQTNHIRENAY
NT seq 1722 nt   +upstreamnt  +downstreamnt
atggatgctaagtcactaactgcctggtcccggacactggtgaccttcaaggatgtattt
gtggacttcaccagggaggagtggaagctgctggacactgctcagcagatcgtgtacaga
aatgtgatgctggagaactataagaacctggtttccttgggttatcagcttactaagcca
gatgtgatcctccggttggagaagggagaagagccctggctggtggagagagaaattcac
caagagacccatcctgattcagagactgcatttgaaatcaaatcatcagtttccagcagg
agcatttttaaagataagcaatcctgtgacattaaaatggaaggaatggcaaggaatgat
ctctggtatttgtcattagaagaagtctggaaatgtagagaccagttagacaagtatcag
gaaaacccagagagacatttgaggcaagtggcattcacccaaaagaaagtacttactcag
gagagagtctctgaaagtggtaaatatgggggaaactgtcttcttcctgctcagctagta
ctgagagagtatttccataaacgtgactcacatactaaaagtttaaaacatgatttagtt
cttaatggtcatcaggacagttgtgcaagtaacagtaatgaatgtggtcaaactttctgt
caaaacattcaccttattcagtttgcaagaactcacacaggtgataaatcctacaaatgc
cctgataatgacaactctcttactcatggttcatctcttggtatatcaaagggcatacat
agagagaaaccctatgaatgtaaggaatgtggaaaattcttcagctggcgctctaatctt
actaggcatcagcttattcatactggagaaaaaccctatgagtgtaaagaatgtggaaag
tctttcagccggagttctcacctcattggacatcaaaagacccatactggtgaggaaccc
tatgaatgtaaagaatgtggaaaatccttcagctggttctctcaccttgttactcatcag
agaactcatacaggagacaaactgtacacatgtaatcagtgtgggaaatcttttgttcat
agctctaggcttattagacaccagaggacacatactggagagaaaccctatgaatgtcct
gaatgtgggaaatctttcagacagagcacacatctcattctgcatcagagaacccatgtg
agagtgaggccctatgaatgcaatgaatgtggaaagtcttacagccagagatctcacctt
gttgtgcatcatagaattcacactggactaaaaccttttgagtgtaaggattgtggaaaa
tgttttagtcgaagctctcacctttattcacatcaaagaacccacactggagagaaacca
tatgagtgtcatgattgtggaaaatctttcagccagagttctgcccttattgtgcatcag
aggatacacactggagagaaaccatatgaatgctgtcagtgtgggaaagccttcatccgg
aagaatgacctcattaagcaccagagaattcatgttggagaagagacctataaatgtaat
caatgtggcattatcttcagccagaactctccatttatagttcatcaaatagctcacact
ggagagcagttcttaacatgcaatcaatgtgggacagcgcttgttaatacctctaacctt
attggataccagacaaatcatattagagaaaatgcttactaa

DBGET integrated database retrieval system