KEGG   Homo sapiens (human): 7561Help
Entry
7561              CDS       T01001                                 

Gene name
ZNF14, GIOT-4, KOX6
Definition
(RefSeq) zinc finger protein 14
  KO
K09228  KRAB domain-containing zinc finger protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:hsa03000]
    7561 (ZNF14)
Transcription factors [BR:hsa03000]
 Eukaryotic Type
  Zinc finger
   Other Cys2His2 zinc factors
    7561 (ZNF14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2H2_6 KRAB zf-C2H2_jaz zf-trcl Zn-ribbon_8 Zn_ribbon_SprT zf_UBZ DUF3268 zf-C2HC_2 zf-met zf-C2H2_11 zinc_ribbon_15
Motif
Other DBs
NCBI-GeneID: 7561
NCBI-ProteinID: NP_066358
OMIM: 194556
HGNC: 12924
Ensembl: ENSG00000105708
Vega: OTTHUMG00000182362
Pharos: P17017(Tdark)
UniProt: P17017
Position
19p13.11
AA seq 642 aa AA seqDB search
MDSVSFEDVAVNFTLEEWALLDSSQKKLYEDVMQETFKNLVCLGKKWEDQDIEDDHRNQG
KNRRCHMVERLCESRRGSKCGETTSQMPNVNINKETFTGAKPHECSFCGRDFIHHSSLNR
HMRSHTGQKPNEYQEYEKQPCKCKAVGKTFSYHHCFRKHERTHTGVKPYECKQCGKAFIY
YQPFQRHERTHAGQKPYECKQCGKTFIYYQSFQKHAHTGKKPYECKQCGKAFICYQSFQR
HKRTHTGEKPYECKQCGKAFSCPTYFRTHERTHTGEKPYKCKECGKAFSFLSSFRRHKRT
HSGEKPYECKECGKAFFYSASFRAHVIIHTGARPYKCKECGKAFNSSNSCRVHERTHIGE
KPYECKRCGKSFSWSISLRLHERTHTGEKPYECKQCHKTFSFSSSLREHETTHTGEKPYE
CKQCGKTFSFSSSLQRHERTHNAEKPYECKQCGKAFRCSSYFRIHERSHTGEKPYECKQC
GKVFIRSSSFRLHERTHTGEKPYECKLCGKTFSFSSSLREHEKIHTGNKPFECKQCGKAF
LRSSQIRLHERTHTGEKPYQCKQCGKAFISSSKFRMHERTHTGEKPYRCKQCGKAFRFSS
SVRIHERSHTGEKPYECKQCGKAFISSSHFRLHERTHMGEKV
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atggactcagtctcctttgaggatgtggccgtgaacttcaccctggaggagtgggctttg
ctggattcttcacagaaaaagctctatgaagatgtgatgcaggagaccttcaaaaacctg
gtttgtctaggaaaaaagtgggaagaccaggacattgaagatgaccacagaaaccagggg
aaaaatcgaagatgtcatatggttgagagactctgtgaaagtagaagaggtagcaaatgt
ggagaaaccactagccagatgccaaatgttaatatcaacaaggaaacttttactggagca
aaaccacatgaatgcagcttttgtggaagagacttcattcatcattcgtcccttaatagg
cacatgagatctcacactggacagaaaccaaatgagtatcaggaatatgaaaagcaacca
tgtaaatgtaaagcagttgggaaaaccttcagttatcaccactgctttcgcaaacatgaa
agaactcacactggagtgaagccctatgaatgtaaacagtgtgggaaagcctttatatat
taccagccatttcaaagacatgaaaggactcatgctggacagaaaccctatgaatgtaag
caatgtggaaaaacctttatatattaccagtcttttcaaaaacatgctcatactggaaag
aaaccctatgaatgtaaacagtgtgggaaagcctttatatgttaccaatcttttcaaaga
cacaaaaggactcacactggagagaaaccctatgaatgtaagcaatgtggtaaggctttc
agttgtcccacatactttcgaactcatgaaagaactcacactggagaaaaaccctacaaa
tgtaaagaatgtggtaaagccttcagttttctcagttcttttcgaaggcataaaaggact
catagtggagagaaaccctatgaatgtaaagaatgtggaaaagccttcttttattctgca
agctttcgagcacatgtaataatacacactggggctcgaccttataaatgtaaagaatgt
gggaaagccttcaactcttctaattcctgtcgagtgcatgaaagaactcatattggagaa
aaaccatatgaatgtaaacgatgtggcaaatcattcagttggtccatttctcttcgattg
catgaaagaactcatactggagagaaaccttatgagtgtaaacagtgtcataaaaccttc
agtttttcaagttcccttcgagaacacgaaacaactcacactggagagaaaccctatgaa
tgtaaacaatgtggtaaaaccttcagtttttcaagttcccttcaaagacatgaaaggact
cacaatgcagagaaaccctatgaatgtaaacagtgtgggaaagccttcaggtgttcaagt
tattttcgaattcatgaaaggtcacacactggagagaaaccctatgaatgtaaacagtgt
ggaaaagttttcattcgttccagttcctttcgactgcatgaaagaacacacactggagag
aaaccctatgaatgtaaactatgcggtaaaaccttcagtttttcaagttcccttcgagaa
catgaaaaaattcacactggaaataagccttttgagtgtaagcaatgtggtaaggccttc
cttcgttccagtcaaattcgattgcatgaaaggactcacactggagagaaaccgtatcaa
tgtaaacaatgtggaaaagccttcatttcttccagtaaatttcgaatgcatgagagaact
cacacgggagagaaaccctatcgatgtaaacaatgtgggaaagccttcagattttcaagt
tctgttcgaattcatgaaaggtctcacactggagagaaaccttatgaatgcaaacaatgt
ggaaaagccttcatttcttccagtcactttcgactgcatgaaaggactcatatgggagag
aaagtctaa

DBGET integrated database retrieval system